SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB12113_complete:A_BomoFB_comp10145_c3_seq1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
PREDICTED:_LOW_QUALITY_PROTEIN:_tyrosine-protein_phosphatase_non-receptor_type_11-like_[Bombyx_mori]
Ontology
GO:0000077 P DNA damage checkpoint signaling
GO:0000187 P obsolete activation of MAPK activity
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0004726 F non-membrane spanning protein tyrosine phosphatase activity
GO:0005070 F obsolete SH3/SH2 adaptor activity
GO:0005158 F insulin receptor binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0006470 P protein dephosphorylation
GO:0006629 P lipid metabolic process
GO:0006641 P triglyceride metabolic process
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007229 P integrin-mediated signaling pathway
GO:0007409 P axonogenesis
GO:0007420 P brain development
GO:0007507 P heart development
GO:0009755 P hormone-mediated signaling pathway
GO:0009967 P positive regulation of signal transduction
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0019904 F protein domain specific binding
GO:0021697 P cerebellar cortex formation
GO:0030220 P platelet formation
GO:0030971 F receptor tyrosine kinase binding
GO:0031748 F D1 dopamine receptor binding
GO:0032528 P microvillus organization
GO:0033277 P abortive mitotic cell cycle
GO:0033628 P regulation of cell adhesion mediated by integrin
GO:0033629 P negative regulation of cell adhesion mediated by integrin
GO:0035264 P multicellular organism growth
GO:0035265 P organ growth
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0035855 P megakaryocyte development
GO:0036302 P atrioventricular canal development
GO:0038127 P ERBB signaling pathway
GO:0040014 P regulation of multicellular organism growth
GO:0042445 P hormone metabolic process
GO:0042593 P glucose homeostasis
GO:0043234 C protein-containing complex
GO:0043254 P regulation of protein-containing complex assembly
GO:0043274 F phospholipase binding
GO:0043560 F insulin receptor substrate binding
GO:0045931 P positive regulation of mitotic cell cycle
GO:0046676 P negative regulation of insulin secretion
GO:0046825 P regulation of protein export from nucleus
GO:0046887 P positive regulation of hormone secretion
GO:0046888 P negative regulation of hormone secretion
GO:0048008 P platelet-derived growth factor receptor signaling pathway
GO:0048011 P neurotrophin TRK receptor signaling pathway
GO:0048013 P ephrin receptor signaling pathway
GO:0048609 P multicellular organismal reproductive process
GO:0048806 P genitalia development
GO:0048839 P inner ear development
GO:0048873 P homeostasis of number of cells within a tissue
GO:0051428 F peptide hormone receptor binding
GO:0051463 P negative regulation of cortisol secretion
GO:0060020 P Bergmann glial cell differentiation
GO:0060125 P negative regulation of growth hormone secretion
GO:0060325 P face morphogenesis
GO:0061582 P intestinal epithelial cell migration
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:2001275 P obsolete positive regulation of glucose import in response to insulin stimulus
RNA-seq EntryA_BomoFB_comp10145_c3_seq1
Sequence
(Amino Acid)
MITRRWFHPSLNGVDAEKLLMECGHDGYFLARPSSSNKGDFTLSVRRGNEVTHIKIQNNG
EFLDLYGGEKFATLSELVQYYMDNQCQLREKNGNIIRLKTPLNCADPTTERWYHGQLTAK
EAERMMMENGKNGSFLVRESQRQPGDFVLSVRTRDRVTHVIIRRKDNKYDVGGGQQFDDL
VSLIEYYRSFPMVETTGEVLRLIQPFNATRIQVRHFHTRVKQLQKENEGPIESMAYKQGF
WEEFETLQMMENLQLFDRMEGSKPENIRKNRYKNIIPFDHTRVILKDIPPDGPPGSDYIN
ANYIRCDSMDSISDSQEFTGNGSTENGKDGTPSKAKDKSSPVHTSVIVTEEPVKSSKKVH
GNGTHKLPAFEPSVLRPNPNYFNTTIPKSATETENGVPTVHVYNKTYIATQGCLSTTIYP
FWSMIWQEDVRIIIMTTKEIERGKVKCERYWPDLNKTEVVKKYTILNEFESSTPDYTLRR
FLVTKKDETTVKRTIYHFHFTAWPDHRVPSEPGRVLNILLDVNYRLQQIMTGTDPPAQAV
VCVHCSAGIGRTGTFIVIDMILDQIRKEGFDCEIDIHRTVQMVRDQRSGMVQNEAQYKFI
YMAVLEFIETEKQRVGLGPEAAQDSPRARSMPVPFL
*(211 a.a.)

- SilkBase 1999-2023 -