SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB11802_complete:A_BomoFB_comp10109_c2_seq2
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		U1_small_nuclear_ribonucleoprotein_[Operophtera_brumata]
Ontology
GO:0000166 F nucleotide binding
GO:0000243 C commitment complex
GO:0000381 P regulation of alternative mRNA splicing, via spliceosome
GO:0000398 P mRNA splicing, via spliceosome
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005681 C spliceosomal complex
GO:0005685 C U1 snRNP
GO:0006397 P mRNA processing
GO:0007052 P mitotic spindle organization
GO:0016607 C nuclear speck
GO:0022008 P neurogenesis
GO:0030529 C ribonucleoprotein complex
GO:0030619 F U1 snRNA binding
GO:0043484 P regulation of RNA splicing
GO:0048025 P negative regulation of mRNA splicing, via spliceosome
GO:0071004 C U2-type prespliceosome
GO:0071011 C precatalytic spliceosome
GO:0071013 C catalytic step 2 spliceosome
RNA-seq EntryA_BomoFB_comp10109_c2_seq2
Sequence
(Amino Acid)
MRRPIALFVIIFPWCISAAYKHADGKKIDGKRVLVDVERARTVKGWLPRRLGTYLQPDAT
PLARSPSDARSELRGGRGVGGGRCVEGEPQRDGGRGVSGGPQDSSARTNVDSNKDM
*(38 a.a.)

- SilkBase 1999-2023 -