SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB11730_complete:A_BomoFB_comp10094_c0_seq1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
SNF4/AMP-activated_protein_kinase_gamma_subunit_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004679 F AMP-activated protein kinase activity
GO:0004862 F cAMP-dependent protein kinase inhibitor activity
GO:0005524 F ATP binding
GO:0005615 C extracellular space
GO:0005654 C nucleoplasm
GO:0005829 C cytosol
GO:0005977 P glycogen metabolic process
GO:0006110 P regulation of glycolytic process
GO:0006468 P protein phosphorylation
GO:0006469 P negative regulation of protein kinase activity
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006633 P fatty acid biosynthetic process
GO:0007005 P mitochondrion organization
GO:0008603 F cAMP-dependent protein kinase regulator activity
GO:0008607 F phosphorylase kinase regulator activity
GO:0010800 P positive regulation of peptidyl-threonine phosphorylation
GO:0016208 F AMP binding
GO:0019217 P regulation of fatty acid metabolic process
GO:0019901 F protein kinase binding
GO:0030295 F protein kinase activator activity
GO:0031588 C nucleotide-activated protein kinase complex
GO:0032147 P activation of protein kinase activity
GO:0035556 P intracellular signal transduction
GO:0043531 F ADP binding
GO:0045860 P positive regulation of protein kinase activity
GO:0050790 P regulation of catalytic activity
GO:0061024 P membrane organization
GO:0071901 P negative regulation of protein serine/threonine kinase activity
RNA-seq EntryA_BomoFB_comp10094_c0_seq1
Sequence
(Amino Acid)
MLTITDFIKILQMYYTSPDVKMEELEEHRLETWRRVLKGSVMPLVSIGPDSSLFEAIRML
ITNRIHRLPVIDPDTGNVLYILTHKRILRFLFLYINELPKPSYLKSKIRDLRIGTLSDIE
TATEETSIIEALKKFVNRRVSALPLIDPEGRLKDIYAKFDVINLAAEKTYNNLDVTLKTA
NEHRNEWFEGVQKCKLDETLFDVMERIVRAEVHRLVVVDDDDKVIGIISLSDLLMYLVLR
PTGECGVTSLRNEHAPIEEKDENLNPEDVAESGDDKSTVSKEQDDSEERTQCQE
*(97 a.a.)

- SilkBase 1999-2023 -