SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB11684_complete:A_BomoFB_comp10078_c0_seq3
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		neuropeptide_receptor_B1_[Bombyx_mori]
Ontology
GO:0004871 F obsolete signal transducer activity
GO:0004872 F signaling receptor activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0004948 F calcitonin receptor activity
GO:0005515 F protein binding
GO:0005623 C obsolete cell
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007189 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 P activation of adenylate cyclase activity
GO:0007202 P activation of phospholipase C activity
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0008565 F obsolete protein transporter activity
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030819 P obsolete positive regulation of cAMP biosynthetic process
GO:0031623 P receptor internalization
GO:0032841 F calcitonin binding
GO:0045762 P positive regulation of adenylate cyclase activity
GO:0051384 P response to glucocorticoid
GO:0072659 P protein localization to plasma membrane
RNA-seq EntryA_BomoFB_comp10078_c0_seq3
Sequence
(Amino Acid)
MNDPERIARDLLLCEEFNNRTLPPPGLYCEGTFDRWLCWPHTPANSTAYGSCPEFVPGFR
PDLLAHKECTANGTWYKHPETGLPWSNYTTCVVEEDVSDAPPQCAREDATRT
*(36 a.a.)

- SilkBase 1999-2023 -