SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB11582_complete:A_BomoFB_comp10056_c0_seq3
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
PREDICTED:_hairy/enhancer-of-split_related_with_YRPW_motif_protein_isoform_X6_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000983 F RNA polymerase II general transcription initiation factor activity
GO:0000988 F obsolete transcription factor activity, protein binding
GO:0001102 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001568 P blood vessel development
GO:0001570 P vasculogenesis
GO:0003150 P muscular septum morphogenesis
GO:0003151 P outflow tract morphogenesis
GO:0003171 P atrioventricular valve development
GO:0003184 P pulmonary valve morphogenesis
GO:0003186 P tricuspid valve morphogenesis
GO:0003195 P tricuspid valve formation
GO:0003199 P endocardial cushion to mesenchymal transition involved in heart valve formation
GO:0003208 P cardiac ventricle morphogenesis
GO:0003214 P cardiac left ventricle morphogenesis
GO:0003215 P cardiac right ventricle morphogenesis
GO:0003222 P ventricular trabecula myocardium morphogenesis
GO:0003300 P cardiac muscle hypertrophy
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0007389 P pattern specification process
GO:0007507 P heart development
GO:0008134 F transcription factor binding
GO:0009948 P anterior/posterior axis specification
GO:0010460 P positive regulation of heart rate
GO:0010468 P regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0010667 P negative regulation of cardiac muscle cell apoptotic process
GO:0014031 P mesenchymal cell development
GO:0014898 P cardiac muscle hypertrophy in response to stress
GO:0016580 C Sin3 complex
GO:0017053 C transcription repressor complex
GO:0035910 P ascending aorta morphogenesis
GO:0035912 P dorsal aorta morphogenesis
GO:0035939 F microsatellite binding
GO:0036304 P umbilical cord morphogenesis
GO:0042803 F protein homodimerization activity
GO:0042826 F histone deacetylase binding
GO:0043565 F sequence-specific DNA binding
GO:0045165 P cell fate commitment
GO:0045607 P regulation of inner ear auditory receptor cell differentiation
GO:0045746 P negative regulation of Notch signaling pathway
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0055015 P ventricular cardiac muscle cell development
GO:0060045 P positive regulation of cardiac muscle cell proliferation
GO:0060317 P cardiac epithelial to mesenchymal transition
GO:0060347 P heart trabecula formation
GO:0060411 P cardiac septum morphogenesis
GO:0060412 P ventricular septum morphogenesis
GO:0060413 P atrial septum morphogenesis
GO:0060633 P negative regulation of transcription initiation from RNA polymerase II promoter
GO:0060716 P labyrinthine layer blood vessel development
GO:0060840 P artery development
GO:0060842 P arterial endothelial cell differentiation
GO:0060948 P cardiac vascular smooth muscle cell development
GO:0060977 P coronary vasculature morphogenesis
GO:0061156 P pulmonary artery morphogenesis
GO:0061314 P Notch signaling involved in heart development
GO:0065004 P protein-DNA complex assembly
GO:0090102 P cochlea development
GO:0097084 P vascular associated smooth muscle cell development
GO:2000678 P negative regulation of transcription regulatory region DNA binding
GO:2000820 P negative regulation of transcription from RNA polymerase II promoter involved in smooth muscle cell differentiation
GO:2001212 P regulation of vasculogenesis
RNA-seq EntryA_BomoFB_comp10056_c0_seq3
Sequence
(Amino Acid)
METRHYWEENGHAVKYDNYNSNDGFGRVSGEQLSFAAPSEDEAEYPPGSYLKKGKQDPMS
HRIIEKRRRDRMNNCLADLSRLIPPEYLKKGRGRVEKTEIIEMAIRHLKYLQERVNAAER
TSGEEYRAGYQEAVAEAVRFLVEVQGYGPGDGLSVSMTSHLQRHCEAITKGEPVHREKSR
SHPGGSSSETASSSSSSHGYAVKVIASAPPPAPPTFTQEPYDERPPGPYSMDCDRVPVNQ
VSGAEGEAAREGRDAELVTADPRRKCEPTLRAIRKPEHTEDYLHSYKFKNSIERRFSRSQ
DEAAEQAVRIGHGRVYSHKRRRAAKPAPSTSTSASGSTEEARDTSPQDTSSDSPHHHHYE
KPPPPTQYVPVFALNALGKYYVPLSVDYACLARHLGPYDVLDARAVHLSAPLHPVTIHVN
FQPCLNYHVKREPAEREWRPT
*(146 a.a.)

- SilkBase 1999-2023 -