SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB11512_internal:A_BomoFB_comp10043_c1_seq1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		PREDICTED:_cullin-4A_[Papilio_xuthus]
Ontology
GO:0000715 P nucleotide-excision repair, DNA damage recognition
GO:0000717 P nucleotide-excision repair, DNA duplex unwinding
GO:0003684 F damaged DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006281 P DNA repair
GO:0006283 P transcription-coupled nucleotide-excision repair
GO:0006293 P nucleotide-excision repair, preincision complex stabilization
GO:0006294 P nucleotide-excision repair, preincision complex assembly
GO:0006295 P nucleotide-excision repair, DNA incision, 3'-to lesion
GO:0006296 P nucleotide-excision repair, DNA incision, 5'-to lesion
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0016567 P protein ubiquitination
GO:0031175 P neuron projection development
GO:0031461 C cullin-RING ubiquitin ligase complex
GO:0031465 C Cul4B-RING E3 ubiquitin ligase complex
GO:0031625 F ubiquitin protein ligase binding
GO:0033683 P nucleotide-excision repair, DNA incision
GO:0035518 P histone H2A monoubiquitination
GO:0042769 P obsolete DNA damage response, detection of DNA damage
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0045732 P positive regulation of protein catabolic process
GO:0061630 F ubiquitin protein ligase activity
GO:0070062 C extracellular exosome
GO:0070911 P global genome nucleotide-excision repair
GO:0070914 P UV-damage excision repair
GO:1900087 P positive regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_BomoFB_comp10043_c1_seq1
Sequence
(Amino Acid)
PRRLQTTGLLLFQHLSASTETSGPGGVELSVHILTMGFWPTYRACEVRLPTELTRQQEHF
TKFYLAKHSGRKLHWQPTLGHCVLRANFAQGNKELQVSLFQALVLLLFNDGDNLSFEDIK
VSTNIEEGELRRTLQSLACGKARVLSKAPRGR
(49 a.a.)

- SilkBase 1999-2023 -