SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB11511_5prime_partial:A_BomoFB_comp10043_c0_seq1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		PREDICTED:_cullin-4A_[Papilio_polytes]
Ontology
GO:0001701 P in utero embryonic development
GO:0005515 F protein binding
GO:0006281 P DNA repair
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0008284 P positive regulation of cell population proliferation
GO:0016032 P viral process
GO:0016567 P protein ubiquitination
GO:0030097 P hemopoiesis
GO:0030853 P negative regulation of granulocyte differentiation
GO:0031461 C cullin-RING ubiquitin ligase complex
GO:0031464 C Cul4A-RING E3 ubiquitin ligase complex
GO:0031625 F ubiquitin protein ligase binding
GO:0035019 P somatic stem cell population maintenance
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045732 P positive regulation of protein catabolic process
GO:0051246 P regulation of protein metabolic process
GO:0061630 F ubiquitin protein ligase activity
GO:0080008 C Cul4-RING E3 ubiquitin ligase complex
GO:1900087 P positive regulation of G1/S transition of mitotic cell cycle
GO:2000001 P regulation of DNA damage checkpoint
GO:2000819 P regulation of nucleotide-excision repair
RNA-seq EntryA_BomoFB_comp10043_c0_seq1
Sequence
(Amino Acid)
LSKAPRGRDVQDLDHFSFNADFTNKLFRIKINQIQMKETSEEQKATEERVFQDRQYQIDA
AIVRVMKMRKALSHNLLISELYNQLKFPVKPSDLKKRIESLIDRDYMERDKDNPNQYNYV
A
*(39 a.a.)

- SilkBase 1999-2023 -