SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB11325_complete:A_BomoFB_comp10008_c0_seq1
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)
PREDICTED:_proton-coupled_folate_transporter_[Chrysemys_picta_bellii]
Ontology
RNA-seq EntryA_BomoFB_comp10008_c0_seq1
Sequence
(Amino Acid)
MQLGRRILSSHSGRFTTVVRERFQLRVGPSDPHVHRWTGRRRRCPRVPPRVEPHLRADEA
PVAAQTLWRSIKIRYTASAQSNTEGGSKESVHYPTGRDH
*(32 a.a.)

- SilkBase 1999-2022 -