SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB11301_complete:A_BomoFB_comp10002_c0_seq3
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
hypothetical_protein_IscW_ISCW001414_[Ixodes_scapularis]
Ontology
RNA-seq EntryA_BomoFB_comp10002_c0_seq3
Sequence
(Amino Acid)
MSRCTLVSIESRLRFVVLLLFFKLYSNAARFGRVLVAARHIKCIIICGQRALCTVQSLAA
SSGRPAAAATCKSAPRTPRPAARPARFFINKLLSCLLFICISFYIFILLFQIL
*(37 a.a.)

- SilkBase 1999-2022 -