SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB11288_3prime_partial:A_BomoFB_comp9996_c0_seq1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)		PREDICTED:_CDK5_regulatory_subunit-associated_protein_3_[Bombyx_mori]
Ontology
GO:0000079 P regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0001933 P negative regulation of protein phosphorylation
GO:0005515 F protein binding
GO:0005575 C cellular_component
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007346 P regulation of mitotic cell cycle
GO:0008283 P cell population proliferation
GO:0010921 P regulation of phosphatase activity
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0019901 F protein kinase binding
GO:0030262 P apoptotic nuclear changes
GO:0030332 F cyclin binding
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0031398 P positive regulation of protein ubiquitination
GO:0032088 P negative regulation of NF-kappaB transcription factor activity
GO:0032403 F protein-containing complex binding
GO:0043234 C protein-containing complex
GO:0043407 P negative regulation of MAP kinase activity
GO:0044387 P negative regulation of protein kinase activity by regulation of protein phosphorylation
GO:0044389 F ubiquitin-like protein ligase binding
GO:0044818 P mitotic G2/M transition checkpoint
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051019 F mitogen-activated protein kinase binding
GO:0051059 F NF-kappaB binding
GO:0071569 P protein ufmylation
GO:0071901 P negative regulation of protein serine/threonine kinase activity
GO:0097371 F MDM2/MDM4 family protein binding
GO:1900182 P positive regulation of protein localization to nucleus
GO:1901798 P positive regulation of signal transduction by p53 class mediator
GO:1903363 P negative regulation of cellular protein catabolic process
GO:2000060 P positive regulation of ubiquitin-dependent protein catabolic process
RNA-seq EntryA_BomoFB_comp9996_c0_seq1
Sequence
(Amino Acid)
MDESNIPIDINIGKLQDWLISRRHVSKDWQKNVIAVREKINNAIQDMPAHQDIAALLSGS
YINYFHCLKIIEILKETEADTKNLFGRYGSQRMKDWQDVVRNYEKENLYLAEAAQMLVRN
ISYEIPGLKRQIAKEEQAQADFEKKHADYLKNEASSKSEFLALCKQLGIQGEKIKRELVA
KLQELPEIYDQIGKSLKPLQPGIELYNAFTKYILGEDSPEALPILQYVIIHGNTTVYEWS
YGEPPLSLEPDPIHIELDDDEEQASGDQIDFGDNNDIDFSSIDASGAGIDFGDGDGAAEI
DWGNIDIASADENSLLADIEAVSLEGAGIVIEEQGMTGGVARGKDALTLLDNPSTRNQFI
DQLVELESFLKMRVYETTSAAESHTLSLLQQLPAESEPALRGMLGAVQRAADRKST
(137 a.a.)

- SilkBase 1999-2023 -