SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB1126_5prime_partial:A_BomoFB_comp2918_c0_seq1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)		PREDICTED:_peroxisome_biogenesis_factor_2_[Bombyx_mori]
Ontology
GO:0000038 P very long-chain fatty acid metabolic process
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0003674 F molecular_function
GO:0005777 C peroxisome
GO:0005778 C peroxisomal membrane
GO:0005779 C integral component of peroxisomal membrane
GO:0006635 P fatty acid beta-oxidation
GO:0007031 P peroxisome organization
GO:0008150 P biological_process
GO:0008270 F zinc ion binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016558 P protein import into peroxisome matrix
GO:0016593 C Cdc73/Paf1 complex
GO:0031648 P protein destabilization
GO:0046872 F metal ion binding
GO:0048147 P negative regulation of fibroblast proliferation
GO:0050680 P negative regulation of epithelial cell proliferation
RNA-seq EntryA_BomoFB_comp2918_c0_seq1
Sequence
(Amino Acid)
EDLTDFSWTRELLWHNLIELFGTGISLFNIIGLKQRLSKFLKYVWWNKPVHTFSQPGAPN
MTLSTVCACCSNKPVLPHTMGCSHIFCYYCLVANKTMDQDYACPKCYHVGKNVAKLTAS
*(39 a.a.)

- SilkBase 1999-2023 -