SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB1107_3prime_partial:A_BomoFB_comp2898_c0_seq1
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)
PREDICTED:_steroid_hormone_receptor_ERR1_isoform_X1_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003707 F steroid hormone receptor activity
GO:0005496 F steroid binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0008270 F zinc ion binding
GO:0015630 C microtubule cytoskeleton
GO:0019904 F protein domain specific binding
GO:0030278 P regulation of ossification
GO:0032355 P response to estradiol
GO:0042127 P regulation of cell population proliferation
GO:0043401 P steroid hormone mediated signaling pathway
GO:0043565 F sequence-specific DNA binding
GO:0045171 C intercellular bridge
GO:0045667 P regulation of osteoblast differentiation
GO:0045670 P regulation of osteoclast differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0051216 P cartilage development
GO:1900078 P positive regulation of cellular response to insulin stimulus
RNA-seq EntryA_BomoFB_comp2898_c0_seq1
Sequence
(Amino Acid)
MDWMEMEDMVHMMSAVSGEPMLRRVKQETDPSPQYSPPEPQPPHPQPLHPRPMPLMQPEV
PMPLQQLELETKDVKFCVSPEDGTIVGNTSPEQQHCSSTTAAAASGNRDEDTPRRRCLVC
GDVASGFHYGVASCEACKAFFKRTIQGNIDYTCPAANECEINKRRRKACQACRFRKCLRT
GMLREGV
(61 a.a.)

- SilkBase 1999-2023 -