SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB10713_complete:A_BomoFB_comp9849_c0_seq1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		PREDICTED:_transcription_factor_ETV6_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000165 P MAPK cascade
GO:0001709 P cell fate determination
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006897 P endocytosis
GO:0007254 P JNK cascade
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0007391 P dorsal closure
GO:0007464 P R3/R4 cell fate commitment
GO:0007517 P muscle organ development
GO:0008340 P determination of adult lifespan
GO:0008406 P gonad development
GO:0019904 F protein domain specific binding
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0035155 P negative regulation of terminal cell fate specification, open tracheal system
GO:0035157 P negative regulation of fusion cell fate specification
GO:0043565 F sequence-specific DNA binding
GO:0045316 P negative regulation of compound eye photoreceptor development
GO:0045467 P R7 cell development
GO:0045596 P negative regulation of cell differentiation
GO:0045610 P regulation of hemocyte differentiation
GO:0045678 P positive regulation of R7 cell differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046533 P negative regulation of photoreceptor cell differentiation
GO:0046580 P negative regulation of Ras protein signal transduction
GO:0048666 P neuron development
GO:0048747 P muscle cell development
GO:0048749 P compound eye development
GO:0048813 P dendrite morphogenesis
GO:0050767 P regulation of neurogenesis
GO:0060233 P oenocyte delamination
GO:0090175 P regulation of establishment of planar polarity
RNA-seq EntryA_BomoFB_comp9849_c0_seq1
Sequence
(Amino Acid)
MKVVSLQLPSGPSMERLPLPFSPTELLWRYPLPWAPPPPSPLGDTKAQLPAGLPPEPRLW
TREDVSVFLKWCEREFDLPNFDMDLFQMNGKALCLLTKTDLGERCPGAGDVLHNVLQMLV
RDAALLGRVPSSPVTPTARAAPYPPSPHSHPPTPTWTVDGFHHFHSAAAAAAAQPNSVTL
SPAPSVDSSGSPQRGDTVTYAPAYAPSVPPTTQAASSGSNHSDSDEEGQYAPPPRSPKEA
PITSPAPQNHPTQQHPHYRAQHREFFPNDMPESNTNGRLLWDFLQQLLNDPTQRYTNYIA
WKNRDTGVFKIVDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNILRKVQGERHCYQF
LRTQQN
*(121 a.a.)

- SilkBase 1999-2023 -