SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB10698_5prime_partial:A_BomoFB_comp9845_c0_seq1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
PREDICTED:_neuroglian_[Bombyx_mori]
Ontology
GO:0005509 F calcium ion binding
GO:0005886 C plasma membrane
GO:0005918 C septate junction
GO:0005919 C pleated septate junction
GO:0005923 C bicellular tight junction
GO:0007155 P cell adhesion
GO:0007158 P neuron cell-cell adhesion
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007409 P axonogenesis
GO:0007560 P imaginal disc morphogenesis
GO:0008045 P motor neuron axon guidance
GO:0008049 P male courtship behavior
GO:0008050 P female courtship behavior
GO:0008366 P axon ensheathment
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016319 P mushroom body development
GO:0016328 C lateral plasma membrane
GO:0019991 P septate junction assembly
GO:0021682 P nerve maturation
GO:0030054 C cell junction
GO:0030175 C filopodium
GO:0035011 P melanotic encapsulation of foreign target
GO:0035151 P regulation of tube size, open tracheal system
GO:0035230 C cytoneme
GO:0045924 P regulation of female receptivity
GO:0048036 P central complex development
GO:0048675 P axon extension
GO:0048812 P neuron projection morphogenesis
GO:0048813 P dendrite morphogenesis
GO:0050808 P synapse organization
GO:0060857 P establishment of glial blood-brain barrier
GO:0061343 P cell adhesion involved in heart morphogenesis
GO:0072499 P photoreceptor cell axon guidance
RNA-seq EntryA_BomoFB_comp9845_c0_seq1
Sequence
(Amino Acid)
LGLGADLDPVLGVGLEAGEGKGYYVEQSTNNVLTAQPDVPAFETETLPGKEGTAHVIVRW
IPSLDGHAGTHFVAWYRLKGHPDWQRTNDITEDDFVILTGLEPGQLYEVKVTVHDGHYFS
TSELRTVDTSIDGPIVKPDEKIATAGWFIGVMLALAFLLLLLVLVCVLRRNRGGKYDVHD
RELAHGRRDYPDAGFHEYTHPLDNKSRHSMSSGTKPGPESDTDSMAEYGDGETAGMNEDG
SFIGQYGRKRRPPTSGQPDSASQAFATLV
*(89 a.a.)

- SilkBase 1999-2023 -