SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB10496_complete:A_BomoFB_comp9804_c0_seq1
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)		PREDICTED:_RAC_serine/threonine-protein_kinase_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0006629 P lipid metabolic process
GO:0006915 P apoptotic process
GO:0006979 P response to oxidative stress
GO:0007275 P multicellular organism development
GO:0007424 P open tracheal system development
GO:0007427 P epithelial cell migration, open tracheal system
GO:0007520 P myoblast fusion
GO:0007525 P somatic muscle development
GO:0007623 P circadian rhythm
GO:0008284 P positive regulation of cell population proliferation
GO:0008286 P insulin receptor signaling pathway
GO:0008360 P regulation of cell shape
GO:0008361 P regulation of cell size
GO:0008362 P chitin-based embryonic cuticle biosynthetic process
GO:0009986 C cell surface
GO:0010906 P regulation of glucose metabolic process
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0019915 P lipid storage
GO:0030307 P positive regulation of cell growth
GO:0031104 P dendrite regeneration
GO:0035091 F phosphatidylinositol binding
GO:0035206 P regulation of hemocyte proliferation
GO:0035264 P multicellular organism growth
GO:0035556 P intracellular signal transduction
GO:0040008 P regulation of growth
GO:0040014 P regulation of multicellular organism growth
GO:0040018 P positive regulation of multicellular organism growth
GO:0042306 P regulation of protein import into nucleus
GO:0043025 C neuronal cell body
GO:0043066 P negative regulation of apoptotic process
GO:0045793 P positive regulation of cell size
GO:0045886 P negative regulation of synaptic assembly at neuromuscular junction
GO:0046620 P regulation of organ growth
GO:0046622 P positive regulation of organ growth
GO:0048477 P oogenesis
GO:0048680 P positive regulation of axon regeneration
GO:0050773 P regulation of dendrite development
GO:0060292 P long-term synaptic depression
GO:0090278 P negative regulation of peptide hormone secretion
GO:1901215 P negative regulation of neuron death
RNA-seq EntryA_BomoFB_comp9804_c0_seq1
Sequence
(Amino Acid)
MAMAAPGIIVKEGWLQKRGEHIRNWRDRYFILFDTGDLVGFKTQPERNNYRDPLNKFTVR
DCQIMAVDKPRPYTFTIRGLQWTTVIERNFSVDNEKEREEWVKAIREVASQLSTGGPSSA
SMSDADDRDMAQLGTSFRDPRRITLEKFEFVKVLGKGTFGKVVLSREKGTGKLYAMKILK
KHLIIQKDEVAHTITENRVLKKTKHPFLTALRYSFQTADRVCFVMEYANGGELFFHLSRE
RSFTEDRTRFYGAEIVSALGYLHSEGIIYRDLKLENLLLDKDGHIKIADFGLCKVNITYG
RTTKTFCGTPEYLAPEVIEDSDYGPAVDWWGTGVVMYEMACGRLPFYNRDHDVLFGLIIN
EEVRFPRSVSAACRSLLDGLLTKDPRARLGAGPDDAHEIMNHPFFASINWNDLVAKKIPP
PFKPQVESDIDTRYFDSEFTGESVELTPPENENSLAFIQEESFPQFSYQDICSSAHSALS
HMSHHSALTDKRH
*(163 a.a.)

- SilkBase 1999-2023 -