| Name | O_BomoFB10206_complete:A_BomoFB_comp9738_c2_seq1 |
| Scaffold_id | Bomo_Chr15 |
NCBI non-redundant
(nr) | PREDICTED:_apoptosis_regulatory_protein_Siva-like_[Amyelois_transitella] |
| Ontology |
| GO:0001618 |
F |
virus receptor activity |
| GO:0005164 |
F |
tumor necrosis factor receptor binding |
| GO:0005175 |
F |
CD27 receptor binding |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005737 |
C |
cytoplasm |
| GO:0005739 |
C |
mitochondrion |
| GO:0006915 |
P |
apoptotic process |
| GO:0006924 |
P |
activation-induced cell death of T cells |
| GO:0008270 |
F |
zinc ion binding |
| GO:0032088 |
P |
negative regulation of NF-kappaB transcription factor activity |
| GO:0046718 |
P |
viral entry into host cell |
| GO:0046872 |
F |
metal ion binding |
| GO:0097191 |
P |
extrinsic apoptotic signaling pathway |
| GO:1901030 |
P |
positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway |
|
| RNA-seq Entry | A_BomoFB_comp9738_c2_seq1 |
Sequence
(Amino Acid) | MTKRTNPFIDDFLPQSKIHVSLKKYDKHSTDNEKRLKKVYEKTLQMLFNGAKKGTTTETN
NNLQDSKVRKDKKKQLFIGKDGNLLHSGCLIETQSIRKNCHCGVTSETKCAYCEFVLCDS
CLHTCAGCEQVYCNKCLFVGSEGSEICVSCYS
*(50 a.a.) |
