SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB10177_complete:A_BomoFB_comp9730_c0_seq4
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
PREDICTED:_aurora_kinase_B_[Amyelois_transitella]
Ontology
GO:0000070 P mitotic sister chromatid segregation
GO:0000166 F nucleotide binding
GO:0000281 P mitotic cytokinesis
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000780 C condensed chromosome, centromeric region
GO:0000920 P septum digestion after cytokinesis
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004712 F protein serine/threonine/tyrosine kinase activity
GO:0005524 F ATP binding
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005876 C spindle microtubule
GO:0006325 P chromatin organization
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007052 P mitotic spindle organization
GO:0007059 P chromosome segregation
GO:0007067 P mitotic cell cycle
GO:0007076 P mitotic chromosome condensation
GO:0008608 P attachment of spindle microtubules to kinetochore
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016568 P chromatin organization
GO:0016572 P histone phosphorylation
GO:0016740 F transferase activity
GO:0019233 P sensory perception of pain
GO:0022008 P neurogenesis
GO:0030496 C midbody
GO:0031577 P spindle checkpoint signaling
GO:0031616 C spindle pole centrosome
GO:0032133 C chromosome passenger complex
GO:0032465 P regulation of cytokinesis
GO:0032467 P positive regulation of cytokinesis
GO:0035174 F histone serine kinase activity
GO:0043988 P histone H3-S28 phosphorylation
GO:0046872 F metal ion binding
GO:0048132 P female germ-line stem cell asymmetric division
GO:0051233 C spindle midzone
GO:0051301 P cell division
GO:0051321 P meiotic cell cycle
GO:0090307 P mitotic spindle assembly
GO:1990385 C meiotic spindle midzone
RNA-seq EntryA_BomoFB_comp9730_c0_seq4
Sequence
(Amino Acid)
MTMKSEVLELETKIINHDAYGSSYKWSPRDFELGSSLGQGKFGHVHVAREKKTGFLVAIK
TLFKSQIVKSKCERQVMREIEIQSHLKHSNILRLLTWFHDERRIYLVVEFAAGGELYKHL
TNSPQGRFPESKAARYIYQVADAVEYCHQHHVIHRDIKPENILVAFSGDLKLADFGWSVH
APSERYLTLF
*(62 a.a.)

- SilkBase 1999-2023 -