SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE61_5prime_partial:A_BomoEE_comp1021_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
hypothetical_protein_KGM_22023_[Danaus_plexippus]
Ontology
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0006810 P transport
GO:0006836 P neurotransmitter transport
GO:0006886 P intracellular protein transport
GO:0006887 P exocytosis
GO:0007269 P neurotransmitter secretion
GO:0010628 P positive regulation of gene expression
GO:0017137 F small GTPase binding
GO:0017156 P calcium-ion regulated exocytosis
GO:0017157 P regulation of exocytosis
GO:0019933 P cAMP-mediated signaling
GO:0030054 C cell junction
GO:0030073 P insulin secretion
GO:0030154 P cell differentiation
GO:0042391 P regulation of membrane potential
GO:0043005 C neuron projection
GO:0044325 F transmembrane transporter binding
GO:0045202 C synapse
GO:0046872 F metal ion binding
GO:0048786 C presynaptic active zone
GO:0048791 P calcium ion-regulated exocytosis of neurotransmitter
GO:0061669 P spontaneous neurotransmitter secretion
GO:0070062 C extracellular exosome
GO:0097151 P positive regulation of inhibitory postsynaptic potential
GO:1903861 P positive regulation of dendrite extension
GO:2000463 P positive regulation of excitatory postsynaptic potential
RNA-seq EntryA_BomoEE_comp1021_c0_seq1
Sequence
(Amino Acid)
DVVPLGPGQLPPRNAHLPPLHAEMNISIIMIKGQLELEVSHARRVYGVNGEVPDSYVKCY
LRDGDKWLHKRKTRVIRRTTEPHFKQTLKYQASEALGRTLVVMLWQRCGGFEHNLALGGA
EICLDKLTLPQRTYGWYPLFPATSFAADESPD
*(50 a.a.)

- SilkBase 1999-2023 -