SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE57_internal:A_BomoEE_comp1008_c0_seq1
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)		PREDICTED:_protein_trachealess_isoform_X2_[Amyelois_transitella]
Ontology
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007424 P open tracheal system development
GO:0007425 P epithelial cell fate determination, open tracheal system
GO:0007431 P salivary gland development
GO:0007435 P salivary gland morphogenesis
GO:0007443 P Malpighian tubule morphogenesis
GO:0035277 P spiracle morphogenesis, open tracheal system
GO:0043565 F sequence-specific DNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046331 P lateral inhibition
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0048813 P dendrite morphogenesis
GO:0060173 P limb development
GO:0072175 P epithelial tube formation
RNA-seq EntryA_BomoEE_comp1008_c0_seq1
Sequence
(Amino Acid)
SPASGSEEGSQHGTNNPDVSSQMSLAASGSLYRGMDRAFCVRMKSTLTKRGCHFKSSGYR
VVLMLCRLRPQYSFSHSRKSPTVLLGMVALAIALPPPSVHEIRLESDMFVTRINFDFRIA
HCEPSRVSELLGYTAEELTGKNLYTLCHGEDANKLRKCHLDLMNKGQVLTHYYRIMNKLG
GYTWMQT
(61 a.a.)

- SilkBase 1999-2023 -