SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE540_3prime_partial:A_BomoEE_comp10124_c0_seq1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		tyramine_beta_hydroxylase_precursor_[Bombyx_mori]
Ontology
GO:0002118 P aggressive behavior
GO:0002121 P inter-male aggressive behavior
GO:0003824 F catalytic activity
GO:0004497 F monooxygenase activity
GO:0004500 F dopamine beta-monooxygenase activity
GO:0005507 F copper ion binding
GO:0005575 C cellular_component
GO:0006589 P octopamine biosynthetic process
GO:0007612 P learning
GO:0007613 P memory
GO:0007629 P flight behavior
GO:0008049 P male courtship behavior
GO:0008345 P larval locomotory behavior
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016491 F oxidoreductase activity
GO:0016715 F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen
GO:0030728 P ovulation
GO:0040011 P locomotion
GO:0042136 P neurotransmitter biosynthetic process
GO:0043059 P regulation of forward locomotion
GO:0046872 F metal ion binding
GO:0048047 P mating behavior, sex discrimination
GO:0048149 P behavioral response to ethanol
GO:0050795 P regulation of behavior
GO:0055114 P obsolete oxidation-reduction process
GO:0071927 P octopamine signaling pathway
RNA-seq EntryA_BomoEE_comp10124_c0_seq1
Sequence
(Amino Acid)
MELGLEYTDKMAIPGEQKAFPLTGYCIPQCTGVGLPDEGITVFGSQLHTHLTGAAVWTRH
SRQGVELPVLNKDMHYSTHFQEIRILHRPVKVLPGDFLETTC
(33 a.a.)

- SilkBase 1999-2023 -