SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE227_internal:A_BomoEE_comp3342_c0_seq1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		Slit-like_3_protein_[Papilio_xuthus]
Ontology
GO:0001960 P negative regulation of cytokine-mediated signaling pathway
GO:0004601 F peroxidase activity
GO:0005152 F interleukin-1 receptor antagonist activity
GO:0005201 F extracellular matrix structural constituent
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005615 C extracellular space
GO:0005783 C endoplasmic reticulum
GO:0006955 P immune response
GO:0006979 P response to oxidative stress
GO:0016491 F oxidoreductase activity
GO:0020037 F heme binding
GO:0030198 P extracellular matrix organization
GO:0031012 C extracellular matrix
GO:0042744 P hydrogen peroxide catabolic process
GO:0046872 F metal ion binding
GO:0055114 P obsolete oxidation-reduction process
GO:0070062 C extracellular exosome
GO:0098869 P cellular oxidant detoxification
RNA-seq EntryA_BomoEE_comp3342_c0_seq1
Sequence
(Amino Acid)
NNTKLKEVNNQTFKGVDSLRVLHLENNKLVELKGDEFLHLNSLNELYLDHNAITHVANNT
FSSLKSLSVLRIDDNKLVNFFPWKLLASSSESLAHVSIEGNQYSCDCKSIAE
(36 a.a.)

- SilkBase 1999-2023 -