SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE21672_complete:A_BomoEE_comp70229_c0_seq2
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)		PREDICTED:_homeobox_even-skipped_homolog_protein_1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001709 P cell fate determination
GO:0003007 P heart morphogenesis
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007350 P blastoderm segmentation
GO:0007366 P periodic partitioning by pair rule gene
GO:0007376 P cephalic furrow formation
GO:0007377 P germ-band extension
GO:0007399 P nervous system development
GO:0007417 P central nervous system development
GO:0007507 P heart development
GO:0007512 P adult heart development
GO:0007517 P muscle organ development
GO:0008045 P motor neuron axon guidance
GO:0008595 P anterior/posterior axis specification, embryo
GO:0009997 P negative regulation of cardioblast cell fate specification
GO:0035289 P posterior head segmentation
GO:0035290 P trunk segmentation
GO:0043565 F sequence-specific DNA binding
GO:0045165 P cell fate commitment
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0050770 P regulation of axonogenesis
GO:1901739 P regulation of myoblast fusion
RNA-seq EntryA_BomoEE_comp70229_c0_seq2
Sequence
(Amino Acid)
MKENYVSRPRRCELAAQLQLPESTIKVWFQNRRMKDKRQRIAVAWPYAAVYSDPAFAASI
LQAAASSVGLPYGYPNPALIPPFHNPQLLPAGYPYPYPPYPRYPYIPNQSSPVNEPTIRP
TYPNFNLNVDK
*(43 a.a.)

- SilkBase 1999-2023 -