SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE21640_complete:A_BomoEE_comp70222_c0_seq5
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)		hypothetical_protein_KGM_05226_[Danaus_plexippus]
Ontology
GO:0000186 P obsolete activation of MAPKK activity
GO:0004222 F metalloendopeptidase activity
GO:0005080 F protein kinase C binding
GO:0005178 F integrin binding
GO:0005515 F protein binding
GO:0005518 F collagen binding
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006508 P proteolysis
GO:0006509 P membrane protein ectodomain proteolysis
GO:0007155 P cell adhesion
GO:0007160 P cell-matrix adhesion
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008270 F zinc ion binding
GO:0009986 C cell surface
GO:0010042 P response to manganese ion
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0017124 F SH3 domain binding
GO:0031233 C intrinsic component of external side of plasma membrane
GO:0033627 P cell adhesion mediated by integrin
GO:0033630 P positive regulation of cell adhesion mediated by integrin
GO:0034241 P positive regulation of macrophage fusion
GO:0034612 P response to tumor necrosis factor
GO:0042117 P monocyte activation
GO:0042542 P response to hydrogen peroxide
GO:0043236 F laminin binding
GO:0046872 F metal ion binding
GO:0050714 P positive regulation of protein secretion
GO:0051044 P positive regulation of membrane protein ectodomain proteolysis
GO:0051088 P obsolete PMA-inducible membrane protein ectodomain proteolysis
GO:0051384 P response to glucocorticoid
GO:0051549 P positive regulation of keratinocyte migration
GO:0051592 P response to calcium ion
GO:0070062 C extracellular exosome
GO:0071222 P cellular response to lipopolysaccharide
RNA-seq EntryA_BomoEE_comp70222_c0_seq5
Sequence
(Amino Acid)
MCLKQRCVSVESVRETIVNKHSSICPSNCSGHGVCNSEGHCHCEAGFAPPLCALPGPGGS
VDSGPATDPTIQRNFMVAMYVIFLGIIPSVLLVMFLVYYSRHNVLYWWKKPRKSYVDYLL
CNWNAPDKGAYTNRFKKRTSSLRNLLSFKRNKNATSEACDDNPPAQTQKPVRYKITDFSE
NGQKKLLKKPTKRINKEDIQIGCDPKRPQVPPKPNDIKPNLVIIKQGLASTTNEMVFVGH
KRMYNVGNNGYADMSGANVKVHGRNKI
*(88 a.a.)

- SilkBase 1999-2023 -