SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE21406_complete:A_BomoEE_comp70192_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		PREDICTED:_gamma-aminobutyric_acid_type_B_receptor_subunit_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0001649 P osteoblast differentiation
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0004965 F G protein-coupled GABA receptor activity
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007193 P adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007194 P negative regulation of adenylate cyclase activity
GO:0007214 P gamma-aminobutyric acid signaling pathway
GO:0008021 C synaptic vesicle
GO:0008134 F transcription factor binding
GO:0008285 P negative regulation of cell population proliferation
GO:0014048 P regulation of glutamate secretion
GO:0014049 P positive regulation of glutamate secretion
GO:0014053 P negative regulation of gamma-aminobutyric acid secretion
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030425 C dendrite
GO:0030673 C axolemma
GO:0030817 P obsolete regulation of cAMP biosynthetic process
GO:0031966 C mitochondrial membrane
GO:0032811 P negative regulation of epinephrine secretion
GO:0033602 P negative regulation of dopamine secretion
GO:0035094 P response to nicotine
GO:0038037 C G protein-coupled receptor dimeric complex
GO:0038039 C G protein-coupled receptor heterodimeric complex
GO:0042734 C presynaptic membrane
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043197 C dendritic spine
GO:0043198 C dendritic shaft
GO:0043231 C intracellular membrane-bounded organelle
GO:0045121 C membrane raft
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0045471 P response to ethanol
GO:0050805 P negative regulation of synaptic transmission
GO:0060124 P positive regulation of growth hormone secretion
RNA-seq EntryA_BomoEE_comp70192_c0_seq1
Sequence
(Amino Acid)
MRHSAKLATTSMENGIRKATKRHPWLMMQSGLLLWGLVAFSSQGDRIALTQIEQLTDNHY
VKLGYYDTQADNLTWLDRERWVGGKVPPDRTVVVNELRTVSLPLFACMTALCIAGILAAI
ALIVFNIMHRHRRVIQWSHPACNTVMLCGCCVCLCAAVALGVDGRWVLPQHFNGLCAARA
WLLATGFSMAYGAMFTKVWRVHRHTTKPKIDNKKRIHGWKLYTMVGGLLVVDVALLTAWQ
LRDPLQRRVETFPLEAPRHHDDDVHIRPELEHCESKHNTVWLGVMYGYKGLVLVFGLFLA
YETRSVKVRQINDSRYVGMSIYNVVVLCLITAPVTLVIASQQDAAFAFVSLAIVFCCFLS
MALIFVPKVIEVIRHPTERVESGRGSGSGSAPADEERYRELVKENEELQKLITQKEERIR
VLKQKLAEREAAAADGVTQGTGGGGAVMADLATATSDYGTSTNYTRSSRASVSDLDFSES
YL
*(160 a.a.)

- SilkBase 1999-2023 -