SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE21232_5prime_partial:A_BomoEE_comp70138_c0_seq1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		PREDICTED:_LIM/homeobox_protein_Lhx5_[Amyelois_transitella]
Ontology
GO:0001655 P urogenital system development
GO:0001657 P ureteric bud development
GO:0001702 P gastrulation with mouth forming second
GO:0001705 P ectoderm formation
GO:0001706 P endoderm formation
GO:0001822 P kidney development
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003714 F transcription corepressor activity
GO:0005634 C nucleus
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007267 P cell-cell signaling
GO:0007389 P pattern specification process
GO:0008045 P motor neuron axon guidance
GO:0008270 F zinc ion binding
GO:0009653 P anatomical structure morphogenesis
GO:0009791 P post-embryonic development
GO:0009880 P embryonic pattern specification
GO:0009948 P anterior/posterior axis specification
GO:0009952 P anterior/posterior pattern specification
GO:0009953 P dorsal/ventral pattern formation
GO:0010468 P regulation of gene expression
GO:0010842 P retina layer formation
GO:0021517 P ventral spinal cord development
GO:0021522 P spinal cord motor neuron differentiation
GO:0021527 P spinal cord association neuron differentiation
GO:0021549 P cerebellum development
GO:0021702 P cerebellar Purkinje cell differentiation
GO:0021871 P forebrain regionalization
GO:0021937 P cerebellar Purkinje cell-granule cell precursor cell signaling involved in regulation of granule cell precursor cell proliferation
GO:0040019 P positive regulation of embryonic development
GO:0043234 C protein-containing complex
GO:0043565 F sequence-specific DNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048646 P anatomical structure formation involved in morphogenesis
GO:0048703 P embryonic viscerocranium morphogenesis
GO:0060059 P embryonic retina morphogenesis in camera-type eye
GO:0060322 P head development
GO:0060429 P epithelium development
GO:0060993 P kidney morphogenesis
GO:0061205 P paramesonephric duct development
GO:0072049 P comma-shaped body morphogenesis
GO:0072050 P S-shaped body morphogenesis
GO:0072077 P renal vesicle morphogenesis
GO:0072178 P nephric duct morphogenesis
GO:0072179 P nephric duct formation
GO:0090009 P primitive streak formation
GO:0090190 P positive regulation of branching involved in ureteric bud morphogenesis
GO:0097477 P lateral motor column neuron migration
GO:2000543 P positive regulation of gastrulation
GO:2000744 P positive regulation of anterior head development
GO:2000768 P positive regulation of nephron tubule epithelial cell differentiation
GO:2001141 P regulation of RNA biosynthetic process
RNA-seq EntryA_BomoEE_comp70138_c0_seq1
Sequence
(Amino Acid)
RSRAFRCIAGDGVRNRRAVSSEVPCRGAEVAGFLAAGRGAHAPFHQHHIGKRRGEAGGAM
ACAGCEKPILDKFLLHVLERAWHAACVRCADCRAPLSDKCYSRDNKLFCRNDFFRRYGTK
CSGCGHGISPSDLVRKAREKVFHLNCFTCLVCRKQLSTGEELYVLDDNKFICKEDYLAGK
APTQHPDSLLGSGSDEEEEDESRAANNSSSPAHAPHPALHSELSHNGDTKPHEDSEDQLF
LFPTQGSLDGDPETRDSQAENKSPDDGNGGSKRRGPRTTIKAKQLEILKSAFSQTPKPTR
HIREQLAKETGLPMRVIQVWFQNKRSKERRLKQLTSMGRGPFFGSSRKMRGFPMNLSPGG
LEEGPPGFPYFATADGKFEFGYGPPFHHDAPFFHPPPTMPFNQPGRFAGGMEGVPGGEFP
EQFPPPDHLVLPRPSSPEFTFGDGPPPLHPEGLVW
*(151 a.a.)

- SilkBase 1999-2023 -