SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE21228_internal:A_BomoEE_comp70135_c1_seq1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		PREDICTED:_nicotinic_acetylcholine_receptor_subunit_alpha_7_isoform_X1_[Bombyx_mori]
Ontology
GO:0000187 P obsolete activation of MAPK activity
GO:0001540 F amyloid-beta binding
GO:0001666 P response to hypoxia
GO:0004889 F acetylcholine-gated cation-selective channel activity
GO:0005216 F ion channel activity
GO:0005230 F extracellular ligand-gated ion channel activity
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005892 C acetylcholine-gated channel complex
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006874 P cellular calcium ion homeostasis
GO:0007165 P signal transduction
GO:0007271 P synaptic transmission, cholinergic
GO:0008284 P positive regulation of cell population proliferation
GO:0015464 F acetylcholine receptor activity
GO:0015643 F toxic substance binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017081 F chloride channel regulator activity
GO:0030054 C cell junction
GO:0030424 C axon
GO:0030425 C dendrite
GO:0032720 P negative regulation of tumor necrosis factor production
GO:0034220 P ion transmembrane transport
GO:0035094 P response to nicotine
GO:0042166 F acetylcholine binding
GO:0042803 F protein homodimerization activity
GO:0043204 C perikaryon
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0045766 P positive regulation of angiogenesis
GO:0050890 P cognition
GO:0098655 P cation transmembrane transport
GO:0099565 P chemical synaptic transmission, postsynaptic
RNA-seq EntryA_BomoEE_comp70135_c1_seq1
Sequence
(Amino Acid)
GGRARCSLLAAPAGLLLLLLGLLWPRGVCGGHHEKRLLHHLLDHYNVLERPVVNESDPLQ
LSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNLRWNTSDFGGVKDLRVPPHRLWKPDV
LMYNSADEGFDSTYPTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWT
YDGYQLDLQLQDEAGGDISSFVTNGEWELIGVPGKRNEIYYNCCPEPYIDITFAVVIRRK
TLYYFFNLIVPCVLIASMALLGFTLPPDSGEKLSLGVT
(91 a.a.)

- SilkBase 1999-2023 -