SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE20857_3prime_partial:A_BomoEE_comp70087_c0_seq9
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)		PREDICTED:_putative_adenosylhomocysteinase_3_isoform_X2_[Bombyx_mori]
Ontology
GO:0003723 F RNA binding
GO:0004013 F adenosylhomocysteinase activity
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006378 P mRNA polyadenylation
GO:0006611 P protein export from nucleus
GO:0006730 P one-carbon metabolic process
GO:0010765 P positive regulation of sodium ion transport
GO:0016020 C membrane
GO:0016324 C apical plasma membrane
GO:0016787 F hydrolase activity
GO:0031440 P regulation of mRNA 3'-end processing
GO:0032412 P regulation of ion transmembrane transporter activity
GO:0033353 P S-adenosylmethionine cycle
GO:0038166 P angiotensin-activated signaling pathway
GO:0042045 P epithelial fluid transport
GO:0043231 C intracellular membrane-bounded organelle
GO:0044070 P regulation of anion transport
GO:0051592 P response to calcium ion
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomoEE_comp70087_c0_seq9
Sequence
(Amino Acid)
MFGGKQSVVCGYGEVGKGCCQALKALGCVVYVTEIDPICALQAAMDGFRVVKLNEVIRQV
DIVITATGNKGVVTREHMERMKNGCVVCNMGHSNTEIDVYALKTPDLLWERVRSQVDHII
WPNGKRIVLLAEGRLANLCCSSLPSFVVSVTAATQALALIELYNAPNQRYKVRRLTDQL
(58 a.a.)

- SilkBase 1999-2023 -