SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE2035_complete:A_BomoEE_comp33398_c0_seq1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)		hypothetical_protein_KGM_08512_[Danaus_plexippus]
Ontology
GO:0000070 P mitotic sister chromatid segregation
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0000922 C spindle pole
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005643 C nuclear pore
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007093 P mitotic cell cycle checkpoint signaling
GO:0007094 P mitotic spindle assembly checkpoint signaling
GO:0042177 P negative regulation of protein catabolic process
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043066 P negative regulation of apoptotic process
GO:0045841 P negative regulation of mitotic metaphase/anaphase transition
GO:0045930 P negative regulation of mitotic cell cycle
GO:0048471 C perinuclear region of cytoplasm
GO:0051301 P cell division
GO:0060564 P negative regulation of ubiquitin protein ligase activity
GO:0072686 C mitotic spindle
GO:0090267 P positive regulation of mitotic cell cycle spindle assembly checkpoint
RNA-seq EntryA_BomoEE_comp33398_c0_seq1
Sequence
(Amino Acid)
MSLQQTKNCITLRGSAQIICEYLKFSINSVLFQRGLYPPETFKAENQYGITLLLSEDPQI
KSFLTNLLTQSEEWILDKKVKKLSLIILNVANKEVLECWDFNIQYEDGDTALSKEKNEMV
GSKDLKKIQQEIRDVMLQVAATISYLPLLDCRCSFDVLVHAKTDCDIPEKWAEAQPVAIA
NAQNVQLKSFSTSLHKMETVVSYKLAD
*(68 a.a.)

- SilkBase 1999-2023 -