SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE1978_complete:A_BomoEE_comp33263_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
arginase_[Bombyx_mori]
Ontology
GO:0000050 P urea cycle
GO:0001666 P response to hypoxia
GO:0004053 F arginase activity
GO:0005515 F protein binding
GO:0005739 C mitochondrion
GO:0006525 P arginine metabolic process
GO:0006915 P apoptotic process
GO:0007494 P midgut development
GO:0007584 P response to nutrient
GO:0009635 P response to herbicide
GO:0009725 P response to hormone
GO:0009749 P response to glucose
GO:0010269 P response to selenium ion
GO:0010963 P regulation of L-arginine import across plasma membrane
GO:0014075 P response to amine
GO:0016787 F hydrolase activity
GO:0016813 F hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
GO:0019547 P arginine catabolic process to ornithine
GO:0030324 P lung development
GO:0033197 P response to vitamin E
GO:0042493 P response to xenobiotic stimulus
GO:0043200 P response to amino acid
GO:0045428 P regulation of nitric oxide biosynthetic process
GO:0045988 P negative regulation of striated muscle contraction
GO:0046686 P response to cadmium ion
GO:0046689 P response to mercury ion
GO:0046872 F metal ion binding
GO:0048678 P response to axon injury
GO:0050998 F nitric-oxide synthase binding
GO:0051001 P negative regulation of nitric-oxide synthase activity
GO:0060135 P maternal process involved in female pregnancy
GO:0071222 P cellular response to lipopolysaccharide
GO:0071346 P cellular response to interferon-gamma
GO:0071353 P cellular response to interleukin-4
GO:0071549 P cellular response to dexamethasone stimulus
RNA-seq EntryA_BomoEE_comp33263_c0_seq1
Sequence
(Amino Acid)
MNFVKIFVRKMSQNTILKPLNRVGVIGVPFEKGQKKYGVSIAPAAVRAAGLIDELKEIDG
LDVKDFGDIETSSCENNVNVNNMNHLPLVSACNKNLSERVSHVLKDGRIAVTVGGDHSIG
VGTVDGHYNVNEDMILIWVDAHADINTNKTSESGSVHGMPVALLVRELSDYWPYLPTMDW
QVPRFSIKNLGYIGLRSVDKYERLAIEKYNVPTFTMEDVDLHGVEKSITHLLKVLDPENR
KPIHVSFDIDSLDALEAPSTGTPVRGGLTLREAIKLMEIIHATGRLRAIDLVEINPAIGN
ENDRKRTIEAGLCVLKAALGFSRKGSPPKGITDLPIQTISNN
*(113 a.a.)

- SilkBase 1999-2023 -