SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE19532_5prime_partial:A_BomoEE_comp69796_c0_seq2
Scaffold_idBomo_Scaf015
NCBI non-redundant
(nr)		leucine-rich_repeat_G_protein-coupled_receptor_2,_partial_[Chilo_suppressalis]
Ontology
GO:0001649 P osteoblast differentiation
GO:0002376 P immune system process
GO:0004871 F obsolete signal transducer activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007283 P spermatogenesis
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0030154 P cell differentiation
GO:0030282 P bone mineralization
GO:0032922 P circadian regulation of gene expression
GO:0034122 P negative regulation of toll-like receptor signaling pathway
GO:0045087 P innate immune response
GO:0046849 P bone remodeling
GO:0048511 P rhythmic process
GO:0050710 P negative regulation of cytokine production
GO:0090263 P positive regulation of canonical Wnt signaling pathway
RNA-seq EntryA_BomoEE_comp69796_c0_seq2
Sequence
(Amino Acid)
SRNLLRAVPTHALAPLHHLQTLSLSGNLITELSDSSLPPLPALHTLVLKRNRITHIEPRA
FANTPALHVLRLEENLLSELPPAIQLLPVLQDLLLSGNRIEVVEAGILQQCRLLKRLDLR
GNPLTRLHRHALQHLPHLRTL
*(46 a.a.)

- SilkBase 1999-2023 -