SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE19268_complete:A_BomoEE_comp69682_c0_seq1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)
PREDICTED:_desert_hedgehog_protein_B_[Papilio_xuthus]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001525 P angiogenesis
GO:0001569 P branching involved in blood vessel morphogenesis
GO:0001570 P vasculogenesis
GO:0001656 P metanephros development
GO:0001658 P branching involved in ureteric bud morphogenesis
GO:0001708 P cell fate specification
GO:0001755 P neural crest cell migration
GO:0001822 P kidney development
GO:0001942 P hair follicle development
GO:0001944 P vasculature development
GO:0001947 P heart looping
GO:0001948 F protein binding
GO:0002052 P positive regulation of neuroblast proliferation
GO:0002053 P positive regulation of mesenchymal cell proliferation
GO:0002076 P osteoblast development
GO:0002320 P lymphoid progenitor cell differentiation
GO:0003140 P determination of left/right asymmetry in lateral mesoderm
GO:0005113 F patched binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005539 F glycosaminoglycan binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005615 C extracellular space
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0006355 P regulation of transcription, DNA-templated
GO:0006508 P proteolysis
GO:0006897 P endocytosis
GO:0007154 P cell communication
GO:0007165 P signal transduction
GO:0007224 P smoothened signaling pathway
GO:0007228 P positive regulation of hh target transcription factor activity
GO:0007267 P cell-cell signaling
GO:0007275 P multicellular organism development
GO:0007368 P determination of left/right symmetry
GO:0007389 P pattern specification process
GO:0007398 P ectoderm development
GO:0007405 P neuroblast proliferation
GO:0007411 P axon guidance
GO:0007417 P central nervous system development
GO:0007442 P hindgut morphogenesis
GO:0007507 P heart development
GO:0007596 P blood coagulation
GO:0008209 P androgen metabolic process
GO:0008270 F zinc ion binding
GO:0008283 P cell population proliferation
GO:0008284 P positive regulation of cell population proliferation
GO:0009949 P polarity specification of anterior/posterior axis
GO:0009952 P anterior/posterior pattern specification
GO:0009953 P dorsal/ventral pattern formation
GO:0009986 C cell surface
GO:0010463 P mesenchymal cell proliferation
GO:0010468 P regulation of gene expression
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0014003 P oligodendrocyte development
GO:0014706 P striated muscle tissue development
GO:0014858 P positive regulation of skeletal muscle cell proliferation
GO:0014902 P myotube differentiation
GO:0016020 C membrane
GO:0016539 P intein-mediated protein splicing
GO:0016787 F hydrolase activity
GO:0021513 P spinal cord dorsal/ventral patterning
GO:0021521 P ventral spinal cord interneuron specification
GO:0021522 P spinal cord motor neuron differentiation
GO:0021794 P thalamus development
GO:0021904 P dorsal/ventral neural tube patterning
GO:0021930 P cerebellar granule cell precursor proliferation
GO:0021938 P smoothened signaling pathway involved in regulation of cerebellar granule cell precursor cell proliferation
GO:0021940 P positive regulation of cerebellar granule cell precursor proliferation
GO:0021978 P telencephalon regionalization
GO:0030010 P establishment of cell polarity
GO:0030162 P regulation of proteolysis
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0030323 P respiratory tube development
GO:0030324 P lung development
GO:0030326 P embryonic limb morphogenesis
GO:0030336 P negative regulation of cell migration
GO:0030539 P male genitalia development
GO:0030850 P prostate gland development
GO:0030878 P thyroid gland development
GO:0030900 P forebrain development
GO:0030901 P midbrain development
GO:0030902 P hindbrain development
GO:0031016 P pancreas development
GO:0031069 P hair follicle morphogenesis
GO:0032435 P negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0033077 P T cell differentiation in thymus
GO:0033089 P positive regulation of T cell differentiation in thymus
GO:0033092 P positive regulation of immature T cell proliferation in thymus
GO:0034244 P negative regulation of transcription elongation from RNA polymerase II promoter
GO:0034504 P protein localization to nucleus
GO:0035115 P embryonic forelimb morphogenesis
GO:0035116 P embryonic hindlimb morphogenesis
GO:0042127 P regulation of cell population proliferation
GO:0042130 P negative regulation of T cell proliferation
GO:0042177 P negative regulation of protein catabolic process
GO:0042307 P positive regulation of protein import into nucleus
GO:0042475 P odontogenesis of dentin-containing tooth
GO:0042476 P odontogenesis
GO:0042481 P regulation of odontogenesis
GO:0042733 P embryonic digit morphogenesis
GO:0043010 P camera-type eye development
GO:0043066 P negative regulation of apoptotic process
GO:0043237 F laminin-1 binding
GO:0043369 P CD4-positive or CD8-positive, alpha-beta T cell lineage commitment
GO:0043588 P skin development
GO:0045059 P positive thymic T cell selection
GO:0045060 P negative thymic T cell selection
GO:0045109 P intermediate filament organization
GO:0045121 C membrane raft
GO:0045165 P cell fate commitment
GO:0045445 P myoblast differentiation
GO:0045596 P negative regulation of cell differentiation
GO:0045597 P positive regulation of cell differentiation
GO:0045880 P positive regulation of smoothened signaling pathway
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046638 P positive regulation of alpha-beta T cell differentiation
GO:0046639 P negative regulation of alpha-beta T cell differentiation
GO:0046872 F metal ion binding
GO:0048468 P cell development
GO:0048538 P thymus development
GO:0048546 P digestive tract morphogenesis
GO:0048557 P embryonic digestive tract morphogenesis
GO:0048568 P embryonic organ development
GO:0048589 P developmental growth
GO:0048598 P embryonic morphogenesis
GO:0048617 P embryonic foregut morphogenesis
GO:0048643 P positive regulation of skeletal muscle tissue development
GO:0048645 P animal organ formation
GO:0048646 P anatomical structure formation involved in morphogenesis
GO:0048663 P neuron fate commitment
GO:0048706 P embryonic skeletal system development
GO:0048709 P oligodendrocyte differentiation
GO:0048714 P positive regulation of oligodendrocyte differentiation
GO:0048754 P branching morphogenesis of an epithelial tube
GO:0048839 P inner ear development
GO:0048856 P anatomical structure development
GO:0048859 P formation of anatomical boundary
GO:0048864 P stem cell development
GO:0051146 P striated muscle cell differentiation
GO:0051155 P positive regulation of striated muscle cell differentiation
GO:0051781 P positive regulation of cell division
GO:0060020 P Bergmann glial cell differentiation
GO:0060021 P roof of mouth development
GO:0060070 P canonical Wnt signaling pathway
GO:0060173 P limb development
GO:0060174 P limb bud formation
GO:0060425 P lung morphogenesis
GO:0060428 P lung epithelium development
GO:0060438 P trachea development
GO:0060439 P trachea morphogenesis
GO:0060441 P epithelial tube branching involved in lung morphogenesis
GO:0060442 P branching involved in prostate gland morphogenesis
GO:0060445 P branching involved in salivary gland morphogenesis
GO:0060447 P bud outgrowth involved in lung branching
GO:0060458 P right lung development
GO:0060459 P left lung development
GO:0060463 P lung lobe morphogenesis
GO:0060484 P lung-associated mesenchyme development
GO:0060516 P primary prostatic bud elongation
GO:0060523 P prostate epithelial cord elongation
GO:0060662 P salivary gland cavitation
GO:0060664 P epithelial cell proliferation involved in salivary gland morphogenesis
GO:0060684 P epithelial-mesenchymal cell signaling
GO:0060685 P regulation of prostatic bud formation
GO:0060738 P epithelial-mesenchymal signaling involved in prostate gland development
GO:0060768 P regulation of epithelial cell proliferation involved in prostate gland development
GO:0060769 P positive regulation of epithelial cell proliferation involved in prostate gland development
GO:0060782 P regulation of mesenchymal cell proliferation involved in prostate gland development
GO:0060783 P mesenchymal smoothened signaling pathway involved in prostate gland development
GO:0060840 P artery development
GO:0060916 P mesenchymal cell proliferation involved in lung development
GO:0060979 P vasculogenesis involved in coronary vascular morphogenesis
GO:0061053 P somite development
GO:0061189 P positive regulation of sclerotome development
GO:0071285 P cellular response to lithium ion
GO:0071542 P dopaminergic neuron differentiation
GO:0072001 P renal system development
GO:0072136 P metanephric mesenchymal cell proliferation involved in metanephros development
GO:0080125 P obsolete multicellular structure septum development
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0090370 P negative regulation of cholesterol efflux
GO:0097190 P apoptotic signaling pathway
GO:1900180 P regulation of protein localization to nucleus
GO:1904339 P negative regulation of dopaminergic neuron differentiation
GO:2000062 P negative regulation of ureter smooth muscle cell differentiation
GO:2000063 P positive regulation of ureter smooth muscle cell differentiation
GO:2000357 P negative regulation of kidney smooth muscle cell differentiation
GO:2000358 P positive regulation of kidney smooth muscle cell differentiation
GO:2000729 P positive regulation of mesenchymal cell proliferation involved in ureter development
GO:2001054 P negative regulation of mesenchymal cell apoptotic process
RNA-seq EntryA_BomoEE_comp69682_c0_seq1
Sequence
(Amino Acid)
MLAHGCRAASKGCKFRLGGGRAVESGCGSCSQCRSSRGARWSCVERVWSDVCEMRLSLVL
LWLGAAAACGPGRGFNRRHGPRRITPLVFGQHDPNVSENKNTASGPPEGRITRDDERFKD
LVPNYNPDIDFRDDEGTGADRLMTQGTLVQRQEIDLPINQRVTQKAKEA
*(55 a.a.)

- SilkBase 1999-2023 -