SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE19255_complete:A_BomoEE_comp69674_c2_seq1
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)		PREDICTED:_gamma-aminobutyric_acid_receptor_subunit_beta,_partial_[Bactrocera_oleae]
Ontology
GO:0001505 P regulation of neurotransmitter levels
GO:0004890 F GABA-A receptor activity
GO:0005216 F ion channel activity
GO:0005230 F extracellular ligand-gated ion channel activity
GO:0005254 F chloride channel activity
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006821 P chloride transport
GO:0006836 P neurotransmitter transport
GO:0007214 P gamma-aminobutyric acid signaling pathway
GO:0007268 P chemical synaptic transmission
GO:0008503 F benzodiazepine receptor activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030285 C integral component of synaptic vesicle membrane
GO:0034220 P ion transmembrane transport
GO:0034707 C chloride channel complex
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0099565 P chemical synaptic transmission, postsynaptic
GO:1902476 P chloride transmembrane transport
RNA-seq EntryA_BomoEE_comp69674_c2_seq1
Sequence
(Amino Acid)
MLLLNYYCHYIECYGLFYQDFTLDFYFRQFWTDPRLAYKKRPGVETLSVGSEFIKNIWVP
DTFFVNEKQSYFHIATTSNEFIRIHHSGSITRSIRCEFCLFIVRFECFTGNQDSQTNTRY
LMLSCYWSTRSQKGNAAAVLRT
*(46 a.a.)

- SilkBase 1999-2023 -