SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE19103_5prime_partial:A_BomoEE_comp69643_c0_seq5
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)
PREDICTED:_homeobox_protein_cut_isoform_X5_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000278 P mitotic cell cycle
GO:0000976 F transcription cis-regulatory region binding
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007417 P central nervous system development
GO:0007422 P peripheral nervous system development
GO:0007424 P open tracheal system development
GO:0007443 P Malpighian tubule morphogenesis
GO:0007469 P antennal development
GO:0007605 P sensory perception of sound
GO:0008052 P sensory organ boundary specification
GO:0008585 P female gonad development
GO:0008587 P imaginal disc-derived wing margin morphogenesis
GO:0016360 P sensory organ precursor cell fate determination
GO:0030707 P ovarian follicle cell development
GO:0030713 P ovarian follicle cell stalk formation
GO:0035277 P spiracle morphogenesis, open tracheal system
GO:0043565 F sequence-specific DNA binding
GO:0045165 P cell fate commitment
GO:0045746 P negative regulation of Notch signaling pathway
GO:0048098 P antennal joint development
GO:0048477 P oogenesis
GO:0048813 P dendrite morphogenesis
GO:0060288 P formation of a compartment boundary
GO:0061332 P Malpighian tubule bud morphogenesis
GO:0070983 P dendrite guidance
RNA-seq EntryA_BomoEE_comp69643_c0_seq5
Sequence
(Amino Acid)
PKPWDKLTEKGRDSYRKMHAWACDEAAIMLLKSLIPKKVGTKDGTPGPGFGRSEGEGDDR
LAHMLSEASHLMKTPSGHHNNDDSRSNEDSSSPRTQCLSPFSNKDSSQNRRLKKYENDDI
PPDKVVRIYHEELAKIMTRRVEDMRHSRDSFPGMLPPFFQQRYGSSHGETARGHSHGARG
LPQGAG
*(61 a.a.)

- SilkBase 1999-2023 -