SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE18796_complete:A_BomoEE_comp69538_c1_seq4
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)		putative_nuclear_receptor_nhr-48_[Danaus_plexippus]
Ontology
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0004879 F nuclear receptor activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0008270 F zinc ion binding
GO:0010906 P regulation of glucose metabolic process
GO:0030522 P intracellular receptor signaling pathway
GO:0042594 P response to starvation
GO:0042632 P cholesterol homeostasis
GO:0043401 P steroid hormone mediated signaling pathway
GO:0043565 F sequence-specific DNA binding
GO:0046872 F metal ion binding
GO:0070328 P triglyceride homeostasis
GO:0070873 P regulation of glycogen metabolic process
RNA-seq EntryA_BomoEE_comp69538_c1_seq4
Sequence
(Amino Acid)
MCEEDQVALLKGGCIEMMVLRSTMTYDGQRNQWKIPHCQEQFGRIGTDVLKLAKGDIYRS
HEAFISTFCARWRTDESVILILSAILLFAPHRPRLVHRDVVKLEQVHTPTHQHVEPQLCT
AFYETCAEEGI
*(43 a.a.)

- SilkBase 1999-2023 -