EntryView

ORF from Assembled RNA_seq Entry

Name

O_BomoEE17956_complete:A_BomoEE_comp69183_c0_seq4

Scaffold_id

NCBI non-redundant
(nr)

PREDICTED:_prolyl_endopeptidase_FAP-like,_partial_[Papilio_polytes]

Ontology

GO:0001525	P	angiogenesis
GO:0002020	F	protease binding
GO:0004175	F	endopeptidase activity
GO:0004252	F	serine-type endopeptidase activity
GO:0005178	F	integrin binding
GO:0005576	C	extracellular region
GO:0005615	C	extracellular space
GO:0005886	C	plasma membrane
GO:0005925	C	focal adhesion
GO:0006508	P	proteolysis
GO:0006915	P	apoptotic process
GO:0007155	P	cell adhesion
GO:0008233	F	peptidase activity
GO:0008236	F	serine-type peptidase activity
GO:0008239	F	dipeptidyl-peptidase activity
GO:0009986	C	cell surface
GO:0010710	P	regulation of collagen catabolic process
GO:0010716	P	negative regulation of extracellular matrix disassembly
GO:0016020	C	membrane
GO:0016021	C	integral component of membrane
GO:0016787	F	hydrolase activity
GO:0030027	C	lamellipodium
GO:0030054	C	cell junction
GO:0031258	C	lamellipodium membrane
GO:0032587	C	ruffle membrane
GO:0042803	F	protein homodimerization activity
GO:0042995	C	cell projection
GO:0043542	P	endothelial cell migration
GO:0045177	C	apical part of cell
GO:0045178	C	basal part of cell
GO:0051603	P	proteolysis involved in cellular protein catabolic process
GO:0060244	P	negative regulation of cell proliferation involved in contact inhibition
GO:0071158	P	regulation of cell cycle
GO:0071438	C	obsolete invadopodium membrane
GO:0071850	P	regulation of cell cycle
GO:0097325	P	melanocyte proliferation
GO:1900119	P	positive regulation of execution phase of apoptosis
GO:1902362	P	melanocyte apoptotic process
GO:1903054	P	negative regulation of extracellular matrix organization

RNA-seq Entry

Sequence
(Amino Acid)

MKLTPPSQDSIKIKLSFQVNTNNPEVTIYVVSLKTPKYLFPHAIQFSSQVDKTWYVRWTE
WMSEKQIAVLLLNRAQNVSIISVCSAAQYNCQDVRLAFSGNVLRSTLQLSSTTIDM
*(38 a.a.)

- SilkBase 1999-2023 -