| Name | O_BomoEE17878_complete:A_BomoEE_comp69147_c0_seq4 |
| Scaffold_id | Bomo_Chr20 |
NCBI non-redundant
(nr) | PREDICTED:_microtubule-actin_cross-linking_factor_1_isoform_X30_[Dinoponera_quadriceps] |
| Ontology |
| GO:0003779 |
F |
actin binding |
| GO:0005509 |
F |
calcium ion binding |
| GO:0005515 |
F |
protein binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005794 |
C |
Golgi apparatus |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005874 |
C |
microtubule |
| GO:0005886 |
C |
plasma membrane |
| GO:0007050 |
P |
regulation of cell cycle |
| GO:0008017 |
F |
microtubule binding |
| GO:0008152 |
P |
metabolic process |
| GO:0010632 |
P |
regulation of epithelial cell migration |
| GO:0016020 |
C |
membrane |
| GO:0016055 |
P |
Wnt signaling pathway |
| GO:0016887 |
F |
ATP hydrolysis activity |
| GO:0030177 |
P |
positive regulation of Wnt signaling pathway |
| GO:0032587 |
C |
ruffle membrane |
| GO:0032886 |
P |
regulation of microtubule-based process |
| GO:0042060 |
P |
wound healing |
| GO:0042995 |
C |
cell projection |
| GO:0043001 |
P |
Golgi to plasma membrane protein transport |
| GO:0046872 |
F |
metal ion binding |
| GO:0051893 |
P |
regulation of focal adhesion assembly |
|
| RNA-seq Entry | A_BomoEE_comp69147_c0_seq4 |
Sequence
(Amino Acid) | MEFENDFSLKEWAKDKPLSILQLDPADRAVLRIADERDAIQKKTFTKWVNKHLKKVNRHV
NDLFEDLRDGLNLISLLEVLSGEHLPRERGRMRFHMLQNVQMALDFLRYKKIKLVNIRAE
DIVDGNPKLTLGLIWTIILHFQVSLLF
*(48 a.a.) |
