SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE17468_3prime_partial:A_BomoEE_comp68974_c0_seq1
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)		delta_precursor_[Bombyx_mori]
Ontology
GO:0001708 P cell fate specification
GO:0001736 P establishment of planar polarity
GO:0005102 F signaling receptor binding
GO:0005112 F Notch binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0007015 P actin filament organization
GO:0007154 P cell communication
GO:0007155 P cell adhesion
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0007314 P oocyte anterior/posterior axis specification
GO:0007398 P ectoderm development
GO:0007399 P nervous system development
GO:0007417 P central nervous system development
GO:0007419 P ventral cord development
GO:0007422 P peripheral nervous system development
GO:0007423 P sensory organ development
GO:0007424 P open tracheal system development
GO:0007451 P dorsal/ventral lineage restriction, imaginal disc
GO:0007460 P R8 cell fate commitment
GO:0007464 P R3/R4 cell fate commitment
GO:0007474 P imaginal disc-derived wing vein specification
GO:0007475 P apposition of dorsal and ventral imaginal disc-derived wing surfaces
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0007498 P mesoderm development
GO:0008284 P positive regulation of cell population proliferation
GO:0008347 P glial cell migration
GO:0008356 P asymmetric cell division
GO:0008407 P chaeta morphogenesis
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016318 P ommatidial rotation
GO:0016330 P second mitotic wave involved in compound eye morphogenesis
GO:0019233 P sensory perception of pain
GO:0030139 C endocytic vesicle
GO:0030154 P cell differentiation
GO:0030707 P ovarian follicle cell development
GO:0030713 P ovarian follicle cell stalk formation
GO:0030718 P germ-line stem cell population maintenance
GO:0030720 P oocyte localization involved in germarium-derived egg chamber formation
GO:0031410 C cytoplasmic vesicle
GO:0035003 C subapical complex
GO:0035155 P negative regulation of terminal cell fate specification, open tracheal system
GO:0035157 P negative regulation of fusion cell fate specification
GO:0036011 P imaginal disc-derived leg segmentation
GO:0042067 P establishment of ommatidial planar polarity
GO:0042676 P compound eye cone cell fate commitment
GO:0045465 P R8 cell differentiation
GO:0045468 P regulation of R8 cell spacing in compound eye
GO:0045931 P positive regulation of mitotic cell cycle
GO:0046331 P lateral inhibition
GO:0046667 P compound eye retinal cell programmed cell death
GO:0048190 P wing disc dorsal/ventral pattern formation
GO:0048477 P oogenesis
GO:0048749 P compound eye development
GO:0048800 P antennal morphogenesis
GO:0048863 P stem cell differentiation
GO:0050768 P negative regulation of neurogenesis
RNA-seq EntryA_BomoEE_comp68974_c0_seq1
Sequence
(Amino Acid)
MRASAVLLALLGFLPQVLTSGFFELRIKSFTNSLGRLSSGQCCDGSSKSDAPCLAPCRTK
FRVCLKIYQANIDTTSPCTFGDITTPVLGGNSLDVPNLNVEGFSNPIVFPFDFTWPGTFS
LIVEAWHDNNDTSRTDDALIGRMTKQSVADVGGPWIEEEQRWGGPSEAHLRVSFRVTCAP
HYYGAGCAVLCRPRDDSFGHYTCSSAGEIVCQDGWTGDYCSKPKCLAGCDSEHGYCTKPD
ECICHSGWVGKRCDKCEPHPGCVHGTCSRPWDCICKEGWGGLFCNQDLNYCTNHRPCRNG
GTCLNTGQGSYTCVCPPEYTGSDCEKSLHSCAVRPCLNGGLCVPDEGGELSCTCPQGYEG
ARCETRRLTCFDRPCHNGGTCEPKSSGYVCVCPVGFAGTDCALEADPCAANPCRNGATCS
RAGNGFKCTCRTGFRGNRCEIDIDDCAGILCEHGGTCVDLVNGQKCQCAPGFLGPRCETR
VDMCLTKPCANGGECLVLDNDYGCRCRPGFTGKDCSIDIDECASSPCRNGGTCRDRVDGY
RCVCPHGWGGRSCTVSLSELAAKQAGGHLPRVGDSDEEERLSAQQVAWIAALGALVPAGA
GAAALAVVCVRRRRARAA
(205 a.a.)

- SilkBase 1999-2023 -