| Name | O_BomoEE17457_5prime_partial:A_BomoEE_comp68972_c0_seq7 |
| Scaffold_id | Bomo_Chr6 |
NCBI non-redundant
(nr) | hypothetical_protein_KGM_13986_[Danaus_plexippus] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0003774 |
F |
cytoskeletal motor activity |
| GO:0003779 |
F |
actin binding |
| GO:0005515 |
F |
protein binding |
| GO:0005516 |
F |
calmodulin binding |
| GO:0005524 |
F |
ATP binding |
| GO:0005829 |
C |
cytosol |
| GO:0005859 |
C |
muscle myosin complex |
| GO:0006936 |
P |
muscle contraction |
| GO:0006939 |
P |
smooth muscle contraction |
| GO:0008307 |
F |
structural constituent of muscle |
| GO:0016459 |
C |
myosin complex |
| GO:0030241 |
P |
skeletal muscle myosin thick filament assembly |
| GO:0032982 |
C |
myosin filament |
| GO:0042470 |
C |
melanosome |
| GO:0048251 |
P |
elastic fiber assembly |
| GO:0048739 |
P |
cardiac muscle cell development |
| GO:0051015 |
F |
actin filament binding |
| GO:0070062 |
C |
extracellular exosome |
| GO:0098779 |
P |
positive regulation of mitophagy in response to mitochondrial depolarization |
|
| RNA-seq Entry | A_BomoEE_comp68972_c0_seq7 |
Sequence
(Amino Acid) | NVRGSTTAPPRAAPPEHARDNEHFAFTKAAMASLGFSGVECGAVLRVLAFVLKLGNVQFE
PQHNIDGSIGVRLEQQYGELSYPANCPVNYPANCSAYYLANCPDYYPANCPANYPANCPA
AKQYLDCICGCHWWCSVRDIPTGRIIPVLAAKQF
*(50 a.a.) |
