SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE17107_complete:A_BomoEE_comp68824_c0_seq2
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
PREDICTED:_multidrug_resistance_protein_homolog_49-like_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0002481 P antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
GO:0002485 P antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
GO:0002489 P antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent
GO:0002591 P positive regulation of antigen processing and presentation of peptide antigen via MHC class I
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006855 P xenobiotic transmembrane transport
GO:0008152 P metabolic process
GO:0008559 F ABC-type xenobiotic transporter activity
GO:0015562 F efflux transmembrane transporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016887 F ATP hydrolysis activity
GO:0030154 P cell differentiation
GO:0042391 P regulation of membrane potential
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0042908 P xenobiotic transport
GO:0048058 P compound eye corneal lens development
GO:0055085 P transmembrane transport
RNA-seq EntryA_BomoEE_comp68824_c0_seq2
Sequence
(Amino Acid)
MHRESMNRNHFVRGSRRLRSISSAHLPVTAVPDLLNYVEPEETEDESVPEVSSLALMKLN
APEWPLLMGGGVASFLVGSTMPIFALLFSKLYGVSILNKYLTNSKHKGSISSR
*(37 a.a.)

- SilkBase 1999-2023 -