SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE16657_complete:A_BomoEE_comp68616_c0_seq4
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
PREDICTED:_long-chain_fatty_acid_transport_protein_4-like_isoform_X2_[Bombyx_mori]
Ontology
GO:0000038 P very long-chain fatty acid metabolic process
GO:0000166 F nucleotide binding
GO:0001561 P fatty acid alpha-oxidation
GO:0001676 P long-chain fatty acid metabolic process
GO:0003824 F catalytic activity
GO:0004467 F long-chain fatty acid-CoA ligase activity
GO:0005102 F signaling receptor binding
GO:0005524 F ATP binding
GO:0005739 C mitochondrion
GO:0005777 C peroxisome
GO:0005778 C peroxisomal membrane
GO:0005779 C integral component of peroxisomal membrane
GO:0005783 C endoplasmic reticulum
GO:0005788 C endoplasmic reticulum lumen
GO:0005789 C endoplasmic reticulum membrane
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006635 P fatty acid beta-oxidation
GO:0006699 P bile acid biosynthetic process
GO:0008152 P metabolic process
GO:0015245 F fatty acid transmembrane transporter activity
GO:0015908 P fatty acid transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016874 F ligase activity
GO:0019899 F enzyme binding
GO:0030176 C integral component of endoplasmic reticulum membrane
GO:0031957 F very long-chain fatty acid-CoA ligase activity
GO:0042760 P very long-chain fatty acid catabolic process
GO:0044539 P long-chain fatty acid import into cell
GO:0050197 F phytanate-CoA ligase activity
GO:0070062 C extracellular exosome
GO:0070251 F pristanate-CoA ligase activity
GO:0097089 P methyl-branched fatty acid metabolic process
RNA-seq EntryA_BomoEE_comp68616_c0_seq4
Sequence
(Amino Acid)
MVRSKRWGRQDATVAELFTRRAKRNPDAPCFIVVGDRTWTFGQIASKSNQVARTMQEHLQ
LKRGDVVCVFLPNSGEYIWTWLGIAKVGGVSALINSNLRHKPLLHCIQVANAKAVIFSDQ
LTDAIDEIRDQLPKGLKMFQLYGKSKPGILDLENEMSKHSTDYPVVTEKLHYKDTLLYIY
TSGTTGMPKAAVMPNSK
*(65 a.a.)

- SilkBase 1999-2023 -