SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE16607_complete:A_BomoEE_comp68582_c0_seq3
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)		PREDICTED:_Bardet-Biedl_syndrome_2_protein_homolog_[Bombyx_mori]
Ontology
GO:0001103 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005902 C microvillus
GO:0005929 C cilium
GO:0006810 P transport
GO:0007288 P sperm axoneme assembly
GO:0007601 P visual perception
GO:0008104 P protein localization
GO:0010629 P negative regulation of gene expression
GO:0014824 P artery smooth muscle contraction
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0021756 P striatum development
GO:0021766 P hippocampus development
GO:0021987 P cerebral cortex development
GO:0030030 P cell projection organization
GO:0030534 P adult behavior
GO:0031514 C motile cilium
GO:0032420 C stereocilium
GO:0033210 P leptin-mediated signaling pathway
GO:0033365 P protein localization to organelle
GO:0034464 C BBSome
GO:0035058 P non-motile cilium assembly
GO:0036064 C ciliary basal body
GO:0038108 P negative regulation of appetite by leptin-mediated signaling pathway
GO:0040015 P negative regulation of multicellular organism growth
GO:0040018 P positive regulation of multicellular organism growth
GO:0042311 P vasodilation
GO:0042384 P cilium assembly
GO:0042995 C cell projection
GO:0043001 P Golgi to plasma membrane protein transport
GO:0044321 P response to leptin
GO:0045444 P fat cell differentiation
GO:0045494 P photoreceptor cell maintenance
GO:0048854 P brain morphogenesis
GO:0051216 P cartilage development
GO:0060170 C ciliary membrane
GO:0060271 P cilium assembly
GO:0060296 P regulation of cilium beat frequency involved in ciliary motility
GO:1903441 P protein localization to ciliary membrane
RNA-seq EntryA_BomoEE_comp68582_c0_seq3
Sequence
(Amino Acid)
MITFDFDRDGESELIVGSEDSFIRVLKNNQFVAEIAETGPVVCLSVISDVRFAYGLANGT
IGIYEDGVRLWRVKSKQNAISLQWSGEALACCWSNGRVDWRDGSSGRVLRRVQMRASAAA
MLLADYRALGTPDLVCVSVRGEVLGYSPTQESSGFNDTTKNPATEEDRLAITELLNKKQA
LMLELQHYEANAASAVMPDLEDDRPTTAMPTNTRLQVAVVHSLDEGCLNLAISTNNETIV
RAALILAEGIFESGETLARHPPLSQIRPILHVPLHPPRDVPVDVHIKALVGYPNSEQYHI
FEMTKQLPRFAMYTMNYNATNRINYNSSYVTFQITERLQRICIWANQNFLLENELELNSE
DAKEFHVNLTCLRDQSTLDMNFNVDGNVKITTSDMRLAGDLVQSLAVFLNLTDLKSTANF
VEAEKKLREEMENASQAGEMRSRLAAETAERAQLITALLPAAQDAASYDL
*(156 a.a.)

- SilkBase 1999-2023 -