SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE1624_complete:A_BomoEE_comp32270_c0_seq1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
(6-4)_photolyase_[Operophtera_brumata]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000166 F nucleotide binding
GO:0000989 F obsolete transcription factor activity, transcription factor binding
GO:0001046 F core promoter sequence-specific DNA binding
GO:0001047 F core promoter sequence-specific DNA binding
GO:0003690 F double-stranded DNA binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0006094 P gluconeogenesis
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006975 P DNA damage induced protein phosphorylation
GO:0007165 P signal transduction
GO:0007623 P circadian rhythm
GO:0008134 F transcription factor binding
GO:0009881 F photoreceptor activity
GO:0018298 P protein-chromophore linkage
GO:0019900 F kinase binding
GO:0019901 F protein kinase binding
GO:0019902 F phosphatase binding
GO:0019915 P lipid storage
GO:0031397 P negative regulation of protein ubiquitination
GO:0032868 P response to insulin
GO:0032922 P circadian regulation of gene expression
GO:0033762 P response to glucagon
GO:0035257 F nuclear receptor binding
GO:0042593 P glucose homeostasis
GO:0042752 P regulation of circadian rhythm
GO:0042754 P negative regulation of circadian rhythm
GO:0042826 F histone deacetylase binding
GO:0043130 F ubiquitin binding
GO:0043153 P entrainment of circadian clock by photoperiod
GO:0045744 P negative regulation of G protein-coupled receptor signaling pathway
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0048511 P rhythmic process
GO:0050896 P response to stimulus
GO:2000001 P regulation of DNA damage checkpoint
GO:2000323 P negative regulation of glucocorticoid receptor signaling pathway
GO:2000850 P negative regulation of glucocorticoid secretion
RNA-seq EntryA_BomoEE_comp32270_c0_seq1
Sequence
(Amino Acid)
MSKTPTVIHWFRLDLRIHDNLALRNAINEAENRKHLLRPIYFLDPNIKDKVGINRLRFLL
QSLEDLDNNLKKLNTCLYVLRGKAVDLLPKLFDDWQVKYLTCQVDIDPEFVQQDEYIEDI
AEKKGVFINKRVQHTVYDVHKVLRENNGAVPLTYQKFLSLVKSINVKEPIEISNVLSSHC
KPIDIQSENYSIPNLKELQIDEETLAPVKYHGGETEALKRLNLYMSKKEWVCKFEKPNSS
PNSIEPSTTVLSPYISHGCLSAKLFYYKLKEVENGRQHTLPPVSLMGQLMWREFYYTAGT
GVANFDKMVGNAICIQIPWTKNDAFLKAWAEGKTGYPFVDAIMRQLKQEGWIHHLARHMV
ACFLTRGDLWISWEEGAKIFEDYLLDYDWSLNAGNWMWLSASAFFYKYFRVYSPVAFGQK
TDKEGVYIKKYVPELKKYPRE
*(146 a.a.)

- SilkBase 1999-2023 -