| Name | O_BomoEE16224_complete:A_BomoEE_comp68433_c0_seq3 |
| Scaffold_id | Bomo_Chr7 |
NCBI non-redundant
(nr) | PREDICTED:_uncharacterized_protein_LOC101746017_isoform_X1_[Bombyx_mori] |
| Ontology |
| GO:0000045 |
P |
autophagosome assembly |
| GO:0000421 |
C |
autophagosome membrane |
| GO:0000422 |
P |
autophagy of mitochondrion |
| GO:0005515 |
F |
protein binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005776 |
C |
autophagosome |
| GO:0005829 |
C |
cytosol |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005874 |
C |
microtubule |
| GO:0006914 |
P |
autophagy |
| GO:0006995 |
P |
cellular response to nitrogen starvation |
| GO:0008017 |
F |
microtubule binding |
| GO:0012505 |
C |
endomembrane system |
| GO:0016020 |
C |
membrane |
| GO:0016236 |
P |
macroautophagy |
| GO:0031090 |
C |
organelle membrane |
| GO:0031410 |
C |
cytoplasmic vesicle |
| GO:0031625 |
F |
ubiquitin protein ligase binding |
|
| RNA-seq Entry | A_BomoEE_comp68433_c0_seq3 |
Sequence
(Amino Acid) | MELNFITTLIKHDVNHNVKQCFKSKKPFIIRKEEVMAIKSKFPTKIPLIVERYHKERNLP
TLDKKKFLVPEDITMSQFLVIIRNRIRVKPNQVSVFKNLKKLLCRILKNKKKYFIKYVLI
*(39 a.a.) |
