SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE15879_5prime_partial:A_BomoEE_comp68309_c0_seq4
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)		PREDICTED:_beta-amyloid-like_protein_isoform_X1_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005886 C plasma membrane
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007422 P peripheral nervous system development
GO:0007611 P learning or memory
GO:0007614 P short-term memory
GO:0007616 P long-term memory
GO:0008201 F heparin binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016319 P mushroom body development
GO:0030154 P cell differentiation
GO:0046914 F transition metal ion binding
GO:0048678 P response to axon injury
GO:0048812 P neuron projection morphogenesis
GO:0050808 P synapse organization
GO:0051602 P response to electrical stimulus
GO:1901215 P negative regulation of neuron death
RNA-seq EntryA_BomoEE_comp68309_c0_seq4
Sequence
(Amino Acid)
WRPKRTSVVARRLQERNAAAKMTRAVLFISVFTVLLDVLHAGQATNGADPQVAVLCEAGS
TYHPQYMSAAGRWTPDLTTKPHNCLKDKMEILDYCKKVLSFTFYLFTS
*(35 a.a.)

- SilkBase 1999-2023 -