| Name | O_BomoEE15817_complete:A_BomoEE_comp68284_c0_seq1 |
| Scaffold_id | Bomo_Chr25 |
NCBI non-redundant (nr) | signal_recognition_particle_14_kDa_protein-like_protein_[Bombyx_mori] |
| Ontology |
| GO:0003723 |
F |
RNA binding |
| GO:0005634 |
C |
nucleus |
| GO:0005737 |
C |
cytoplasm |
| GO:0005786 |
C |
signal recognition particle, endoplasmic reticulum targeting |
| GO:0006614 |
P |
SRP-dependent cotranslational protein targeting to membrane |
| GO:0008312 |
F |
7S RNA binding |
| GO:0030529 |
C |
ribonucleoprotein complex |
| GO:0030942 |
F |
endoplasmic reticulum signal peptide binding |
| GO:0042493 |
P |
response to xenobiotic stimulus |
| GO:0044822 |
F |
RNA binding |
| GO:0045047 |
P |
protein targeting to ER |
| GO:0048500 |
C |
signal recognition particle |
| GO:0070062 |
C |
extracellular exosome |
|
| RNA-seq Entry | A_BomoEE_comp68284_c0_seq1 |
Sequence (Amino Acid) | MVLLSNDEFLAELTKLFQKARLAGSITMTMKRYDGRSKPMPRDGTPAVKNPEYKCLLRAQ
SKSKKISTVVEQRDVEKFSTAYSNLLKTSVNGLKRLKKPKKKAMATQ
*(35 a.a.) |