SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE15445_complete:A_BomoEE_comp68080_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
PREDICTED:_filamin-A_isoform_X1_[Bombyx_mori]
Ontology
GO:0001525 P angiogenesis
GO:0001664 F G protein-coupled receptor binding
GO:0001837 P epithelial to mesenchymal transition
GO:0001948 F protein binding
GO:0001974 P blood vessel remodeling
GO:0003007 P heart morphogenesis
GO:0003779 F actin binding
GO:0004871 F obsolete signal transducer activity
GO:0005080 F protein kinase C binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005802 C trans-Golgi network
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005903 C brush border
GO:0005925 C focal adhesion
GO:0005938 C cell cortex
GO:0007195 P adenylate cyclase-inhibiting dopamine receptor signaling pathway
GO:0008134 F transcription factor binding
GO:0010977 P negative regulation of neuron projection development
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0016479 P negative regulation of transcription by RNA polymerase I
GO:0017048 F small GTPase binding
GO:0017160 F small GTPase binding
GO:0019900 F kinase binding
GO:0030030 P cell projection organization
GO:0030036 P actin cytoskeleton organization
GO:0030426 C growth cone
GO:0031267 F small GTPase binding
GO:0031523 C Myb complex
GO:0031532 P actin cytoskeleton reorganization
GO:0031941 C filamentous actin
GO:0032231 P regulation of actin filament bundle assembly
GO:0032432 C actin filament bundle
GO:0034394 P protein localization to cell surface
GO:0034988 F Fc-gamma receptor I complex binding
GO:0042177 P negative regulation of protein catabolic process
GO:0042384 P cilium assembly
GO:0042803 F protein homodimerization activity
GO:0042993 P obsolete positive regulation of transcription factor import into nucleus
GO:0043066 P negative regulation of apoptotic process
GO:0043113 P receptor clustering
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0044822 F RNA binding
GO:0045022 P early endosome to late endosome transport
GO:0045184 P establishment of protein localization
GO:0045216 P cell-cell junction organization
GO:0048365 F small GTPase binding
GO:0050821 P protein stabilization
GO:0051015 F actin filament binding
GO:0051220 P cytoplasmic sequestering of protein
GO:0051764 P actin crosslink formation
GO:0070062 C extracellular exosome
GO:0070527 P platelet aggregation
GO:0071526 P semaphorin-plexin signaling pathway
GO:0090307 P mitotic spindle assembly
GO:1900026 P positive regulation of substrate adhesion-dependent cell spreading
GO:2001046 P positive regulation of integrin-mediated signaling pathway
RNA-seq EntryA_BomoEE_comp68080_c0_seq1
Sequence
(Amino Acid)
MAGPVGGGGGEPTRLIPARVPAVFEISTSPGSATFTKNDVGVTVTSPSRRPVNVRVLDVA
ERPGLYRIEFTPEEVGTHLIDVSIADDKLAGGPLVAKVYDASLIKVTDLGNAVVGQQCQF
KVDASAAGEGQLEISINEGEVPNHVQVVGGGKCLVYWRPEAASPHRVDIKFNGEPVPSSP
FVFQVAPAQRVTIDTSQVELIPVGDVASCSVRVEGSSGGELTVTVRGPRGEVPVRLTGDA
VTGLVASFTPKNVGPHTLTAHYNNQPVPGTPFTCKAYDGKLVSVTGATSARVGVPVQLAV
DAAQAGEGNLEITVSARGLNIPTQVHPQGNARFTVSFTPTEVCDHIVNVSFNKMRVPGCP
LVLPVSEGAGGAARVSVPGPARLHHPAALTLHHATATLDQIEVNVEGRFK
*(136 a.a.)

- SilkBase 1999-2023 -