SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE15398_internal:A_BomoEE_comp68061_c0_seq8
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)		PREDICTED:_protein_serrate_[Bombyx_mori]
Ontology
GO:0001974 P blood vessel remodeling
GO:0002011 P morphogenesis of an epithelial sheet
GO:0002456 P T cell mediated immunity
GO:0003184 P pulmonary valve morphogenesis
GO:0003215 P cardiac right ventricle morphogenesis
GO:0005112 F Notch binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0007154 P cell communication
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0009887 P animal organ morphogenesis
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0032495 P response to muramyl dipeptide
GO:0035909 P aorta morphogenesis
GO:0042127 P regulation of cell population proliferation
GO:0042491 P inner ear auditory receptor cell differentiation
GO:0043010 P camera-type eye development
GO:0045177 C apical part of cell
GO:0045596 P negative regulation of cell differentiation
GO:0045599 P negative regulation of fat cell differentiation
GO:0045639 P positive regulation of myeloid cell differentiation
GO:0045665 P negative regulation of neuron differentiation
GO:0045669 P positive regulation of osteoblast differentiation
GO:0045747 P positive regulation of Notch signaling pathway
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048839 P inner ear development
GO:0060411 P cardiac septum morphogenesis
GO:0061073 P ciliary body morphogenesis
GO:0061156 P pulmonary artery morphogenesis
GO:0061309 P cardiac neural crest cell development involved in outflow tract morphogenesis
GO:0061314 P Notch signaling involved in heart development
GO:0061444 P endocardial cushion cell development
GO:0072006 P nephron development
GO:0072015 P glomerular visceral epithelial cell development
GO:0072017 P distal tubule development
GO:0072070 P loop of Henle development
GO:0097150 P neuronal stem cell population maintenance
GO:2000737 P negative regulation of stem cell differentiation
RNA-seq EntryA_BomoEE_comp68061_c0_seq8
Sequence
(Amino Acid)
TLFRSRVRVLCQPNYYNTTCTTFCRPRDDKFGHYSCTPDGDKHCLPGWQGDNCEKPVCKE
GCHPTHGRCDRPGDCDCRPGWRGELCSQCQPYPGCKHGYCNGSSWDCTCDTNWGGILCDQ
DLNYCGTHEPCQHGGTCENTAPDQYFCRCAEGFSGVDCERVDNPCAPQPCAHGTCSLAGT
TRGFTCTCDRGWGGLLCDTDLDDCASGPCLHGASCRDHLDGFTCECADGWTGPACAEDVD
ECSGRSMTEGALGPCVNAAACNNTAGGYSCACLAGWTGRDCETNVDDCTGQCLHGATCID
LVDDFHCACAAGYAGRTCSLDVDDCAPRPCTNGGECVDLLNAYRCICPVGFSGTNCEDDR
DHCAGSPCGNGAACYTAQSDYYCHCAPGWTGKNCTQRAARDQVSRCSPSPCRNNASCVES
AADVTCVCRDGYTGKTCSVLVEESERCAEGMCANGGTCVREEGSWRCLCAAGWGGGACDS
LLPLAPAAPPPCPCQAGGTCLPSALPPGWACGCREGRTGALCELSLDLCGSSPCRNG
(178 a.a.)

- SilkBase 1999-2023 -