SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE14945_complete:A_BomoEE_comp67975_c0_seq1
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)		PREDICTED:_atf2_isoform_X1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001102 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001158 F cis-regulatory region sequence-specific DNA binding
GO:0003151 P outflow tract morphogenesis
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0004402 F histone acetyltransferase activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0006970 P response to osmotic stress
GO:0006974 P cellular response to DNA damage stimulus
GO:0008134 F transcription factor binding
GO:0008140 F cAMP response element binding protein binding
GO:0009414 P response to water deprivation
GO:0016020 C membrane
GO:0016573 P histone acetylation
GO:0016740 F transferase activity
GO:0019901 F protein kinase binding
GO:0031573 P mitotic intra-S DNA damage checkpoint signaling
GO:0032915 P positive regulation of transforming growth factor beta2 production
GO:0035497 F cAMP response element binding
GO:0035861 C site of double-strand break
GO:0043525 P positive regulation of neuron apoptotic process
GO:0043565 F sequence-specific DNA binding
GO:0045444 P fat cell differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0050680 P negative regulation of epithelial cell proliferation
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0060612 P adipose tissue development
GO:0097186 P amelogenesis
GO:1902110 P positive regulation of mitochondrial membrane permeability involved in apoptotic process
RNA-seq EntryA_BomoEE_comp67975_c0_seq1
Sequence
(Amino Acid)
MVEPEKPFACTMPDCGMTFTNEDHLQLHTKKHDMMLQLGLEQKAAFVADQTPTPTRFIRN
CEEVGLFQDLQNDNPFDEGFKRAMETKQHILSLESIATISNTDDLHTPQMVFPLEHTDST
LFSTTNNQRNITISRSSSDESGAIKEFETTTISKLTNEVTTISRIVEKHDDNRVDDSKLK
DEVIKDSISYSNNIIKIHSEIRRDDMNKNPIQTFEDTTKNNKITDVPPIMSQTSIDYVVE
TLTNDLCNDTANKHDESDNIEVLIRLPNGRQVRMKSVEDEPKVNAKEKLKRVLSEKSKTK
SPTISNLVPISGGTLIPVTIVAAQPQKIPIPPFRVARNYDKKAVKRKNLDTGNQCHSVSS
EKQSDLDSRSAASRRYRARLKESWIKQCEENRQLRASNDRLLSELTKLKLLLTEHLKRCP
NADDISMSCLKFLCKNEALFTFQNLKTL
*(148 a.a.)

- SilkBase 1999-2023 -