SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE14918_complete:A_BomoEE_comp67969_c0_seq1
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
PREDICTED:_ras-like_GTP-binding_protein_Rho1_isoform_X1_[Papilio_polytes]
Ontology
GO:0000166 F nucleotide binding
GO:0000281 P mitotic cytokinesis
GO:0001736 P establishment of planar polarity
GO:0001737 P establishment of imaginal disc-derived wing hair orientation
GO:0001745 P compound eye morphogenesis
GO:0003779 F actin binding
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0006897 P endocytosis
GO:0006974 P cellular response to DNA damage stimulus
GO:0007010 P cytoskeleton organization
GO:0007015 P actin filament organization
GO:0007164 P establishment of tissue polarity
GO:0007165 P signal transduction
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007254 P JNK cascade
GO:0007264 P small GTPase mediated signal transduction
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0007349 P cellularization
GO:0007368 P determination of left/right symmetry
GO:0007369 P gastrulation
GO:0007370 P ventral furrow formation
GO:0007374 P posterior midgut invagination
GO:0007377 P germ-band extension
GO:0007391 P dorsal closure
GO:0007395 P dorsal closure, spreading of leading edge cells
GO:0007405 P neuroblast proliferation
GO:0007411 P axon guidance
GO:0007422 P peripheral nervous system development
GO:0007424 P open tracheal system development
GO:0007435 P salivary gland morphogenesis
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0007601 P visual perception
GO:0008045 P motor neuron axon guidance
GO:0008347 P glial cell migration
GO:0008354 P germ cell migration
GO:0010004 P gastrulation involving germ band extension
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016055 P Wnt signaling pathway
GO:0016203 P muscle attachment
GO:0016318 P ommatidial rotation
GO:0016324 C apical plasma membrane
GO:0016476 P regulation of embryonic cell shape
GO:0019900 F kinase binding
GO:0030036 P actin cytoskeleton organization
GO:0030239 P myofibril assembly
GO:0030334 P regulation of cell migration
GO:0030589 P pseudocleavage involved in syncytial blastoderm formation
GO:0030866 P cortical actin cytoskeleton organization
GO:0030950 P establishment or maintenance of actin cytoskeleton polarity
GO:0031532 P actin cytoskeleton reorganization
GO:0034613 P cellular protein localization
GO:0035006 P melanization defense response
GO:0035099 P hemocyte migration
GO:0035147 P branch fusion, open tracheal system
GO:0035149 P lumen formation, open tracheal system
GO:0035159 P regulation of tube length, open tracheal system
GO:0035277 P spiracle morphogenesis, open tracheal system
GO:0035298 P regulation of Malpighian tubule size
GO:0035317 P imaginal disc-derived wing hair organization
GO:0042060 P wound healing
GO:0042249 P establishment of planar polarity of embryonic epithelium
GO:0044291 C cell-cell contact zone
GO:0045179 C apical cortex
GO:0045184 P establishment of protein localization
GO:0045199 P maintenance of epithelial cell apical/basal polarity
GO:0046663 P dorsal closure, leading edge cell differentiation
GO:0046664 P dorsal closure, amnioserosa morphology change
GO:0048812 P neuron projection morphogenesis
GO:0048813 P dendrite morphogenesis
GO:0050770 P regulation of axonogenesis
GO:0050896 P response to stimulus
GO:0051017 P actin filament bundle assembly
GO:0051489 P regulation of filopodium assembly
GO:0051493 P regulation of cytoskeleton organization
GO:0070252 P actin-mediated cell contraction
GO:0070451 C cell hair
GO:0070593 P dendrite self-avoidance
GO:0071896 P protein localization to adherens junction
GO:0071902 P positive regulation of protein serine/threonine kinase activity
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0090251 P protein localization involved in establishment of planar polarity
GO:0090254 P cell elongation involved in imaginal disc-derived wing morphogenesis
GO:0090303 P positive regulation of wound healing
GO:1901739 P regulation of myoblast fusion
GO:1903475 P mitotic actomyosin contractile ring assembly
GO:1904059 P regulation of locomotor rhythm
RNA-seq EntryA_BomoEE_comp67969_c0_seq1
Sequence
(Amino Acid)
MWWCSSSASSGPMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEV
DGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCP
NVPIILVGNKKDLRNDPATINELRKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVR
EVFETATRAALQVKKKKKTRCSLL
*(67 a.a.)

- SilkBase 1999-2023 -