SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE14835_internal:A_BomoEE_comp67924_c0_seq6
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
PREDICTED:_solute_carrier_organic_anion_transporter_family_member_4A1_[Bombyx_mori]
Ontology
GO:0001889 P liver development
GO:0005215 F transporter activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006855 P xenobiotic transmembrane transport
GO:0006857 P oligopeptide transport
GO:0008206 P bile acid metabolic process
GO:0008514 F organic anion transmembrane transporter activity
GO:0015125 F bile acid transmembrane transporter activity
GO:0015198 F oligopeptide transmembrane transporter activity
GO:0015238 F xenobiotic transmembrane transporter activity
GO:0015347 F sodium-independent organic anion transmembrane transporter activity
GO:0015721 P bile acid and bile salt transport
GO:0015893 P xenobiotic transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0032496 P response to lipopolysaccharide
GO:0033993 P response to lipid
GO:0034097 P response to cytokine
GO:0042493 P response to xenobiotic stimulus
GO:0043252 P sodium-independent organic anion transport
GO:0043434 P response to peptide hormone
GO:0046677 P response to antibiotic
GO:0051384 P response to glucocorticoid
RNA-seq EntryA_BomoEE_comp67924_c0_seq6
Sequence
(Amino Acid)
IHISNKKRNAPLDSNQPHIPYVLYTRRVPGLITVPAGGGGTFLGGWLVKRLELACAGIIK
LCIGATLVAAAFTFCFVLSCDDYPFAGLTVPYNSPAVPGSDGLLAD
(34 a.a.)

- SilkBase 1999-2023 -